KEGG   Homo sapiens (human): 81616Help
Entry
81616             CDS       T01001                                 

Gene name
ACSBG2, BGR, BRGL, PRTD-NY3, PRTDNY3
Definition
(RefSeq) acyl-CoA synthetase bubblegum family member 2
  KO
K15013  long-chain-fatty-acid--CoA ligase ACSBG [EC:6.2.1.3]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00061  Fatty acid biosynthesis
hsa00071  Fatty acid degradation
hsa01100  Metabolic pathways
hsa01212  Fatty acid metabolism
hsa03320  PPAR signaling pathway
hsa04920  Adipocytokine signaling pathway
Module
hsa_M00086  beta-Oxidation, acyl-CoA synthesis
Network
nt06020  beta-Oxidation in mitochondria
  Element
N00765  beta-Oxidation, acyl-CoA synthesis
N00771  CPT2 deficiency in beta-oxidation
N00772  CPT1A deficiency in beta-oxidation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    81616 (ACSBG2)
   00071 Fatty acid degradation
    81616 (ACSBG2)
 09150 Organismal Systems
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    81616 (ACSBG2)
   03320 PPAR signaling pathway
    81616 (ACSBG2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:hsa01004]
    81616 (ACSBG2)
Enzymes [BR:hsa01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.3  long-chain-fatty-acid---CoA ligase
     81616 (ACSBG2)
Lipid biosynthesis proteins [BR:hsa01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   81616 (ACSBG2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AMP-binding Cas_Cas2CT1978
Motif
Other DBs
NCBI-GeneID: 81616
NCBI-ProteinID: NP_001276106
OMIM: 614363
HGNC: 24174
Ensembl: ENSG00000130377
Vega: OTTHUMG00000180754
Pharos: Q5FVE4(Tbio)
UniProt: Q5FVE4 A0A140VJD4
Position
19p13.3
AA seq 666 aa AA seqDB search
MTGTPKTQEGAKDLEVDMNKTEVTPRLWTTCRDGEVLLRLSKHGPGHETPMTIPEFFRES
VNRFGTYPALASKNGKKWEILNFNQYYEACRKAAKSLIKLGLERFHGVGILGFNSAEWFI
TAVGAILAGGLCVGIYATNSAEVCQYVITHAKVNILLVENDQQLQKILSIPQSSLEPLKA
IIQYRLPMKKNNNLYSWDDFMELGRSIPDTQLEQVIESQKANQCAVLIYTSGTTGIPKGV
MLSHDNITWIAGAVTKDFKLTDKHETVVSYLPLSHIAAQMMDIWVPIKIGALTYFAQADA
LKGTLVSTLKEVKPTVFIGVPQIWEKIHEMVKKNSAKSMGLKKKAFVWARNIGFKVNSKK
MLGKYNTPVSYRMAKTLVFSKVKTSLGLDHCHSFISGTAPLNQETAEFFLSLDIPIGELY
GLSESSGPHTISNQNNYRLLSCGKILTGCKNMLFQQNKDGIGEICLWGRHIFMGYLESET
ETTEAIDDEGWLHSGDLGQLDGLGFLYVTGHIKEILITAGGENVPPIPVETLVKKKIPII
SNAMLVGDKLKFLSMLLTLKCEMNQMSGEPLDKLNFEAINFCRGLGSQASTVTEIVKQQD
PLVYKAIQQGINAVNQEAMNNAQRIEKWVILEKDFSIYGGELGPMMKLKRHFVAQKYKKQ
IDHMYH
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atgactggaaccccaaagactcaagaaggagctaaagatcttgaagtagacatgaataaa
acagaagttactcccaggctgtggaccacctgtcgagatggagaagtccttctgaggcta
tccaaacacggaccaggccatgagaccccgatgaccatccctgaattttttcgagagtca
gtcaaccgatttggaacttatccagccctcgcatccaagaatggcaaaaagtgggaaatt
ctgaatttcaaccagtactatgaggcttgtcggaaggctgcaaaatccttgatcaagctg
ggtttggagcgtttccacggagttggtatcctggggtttaactctgcagagtggtttatc
actgctgttggtgccatcctagccgggggtctttgtgttggtatttatgccaccaactct
gccgaggtttgtcaatatgtcatcactcatgccaaagtgaacatcttgctggttgagaat
gatcaacagttacagaaaatcctttcgattccacagagcagcctagagcccctaaaagcg
atcatccagtacagactgccaatgaagaagaacaacaacttgtactcttgggatgatttc
atggaacttggcagaagtatccctgacacccaactggagcaggtcatcgagagccagaag
gcgaatcaatgcgcagtgctcatctacacttcagggaccacaggcatacccaagggagtg
atgctcagtcatgacaacatcacgtggattgcaggagcagtgacaaaggactttaaactg
acagacaagcatgagacggtggttagctacctcccactcagccatattgcagcacagatg
atggacatctgggtacccataaagattggggcgctcacatactttgctcaagcagatgct
ctcaagggcaccttggtaagtactctaaaggaggtaaaacctactgtcttcattggagtg
cctcaaatttgggagaagatacatgagatggtgaagaaaaatagtgccaagtccatgggc
ttgaagaagaaggcattcgtgtgggcaagaaacattggcttcaaggtcaactcaaaaaag
atgttggggaaatataatactcccgtgagctaccgcatggctaagactctcgtgttcagc
aaagtcaagacatcccttggcttggatcactgtcactcttttatcagtgggactgcgccc
ctcaaccaagagactgccgagttctttctaagcttggacatacctataggcgagttgtat
gggttgagtgagagctcgggaccccacacgatatccaaccagaataactacaggcttcta
agctgtggcaagatcttgactgggtgtaagaatatgctgttccagcagaacaaggatggc
attggggagatctgcctctggggtaggcacatcttcatgggctatctggaaagtgagact
gaaactacagaggccatcgatgatgaaggctggctacactctggggatctgggccagctg
gacggtctgggtttcctctatgtcaccggccacatcaaagaaatccttatcactgctggt
ggtgaaaatgtgccccccattcctgttgagaccttggttaagaagaagatccccatcatc
agtaacgccatgttagtaggagataaactgaagtttctgagcatgttgctgacgctgaag
tgtgagatgaatcagatgagcggagaacctctggacaagctgaacttcgaggccatcaac
ttctgtcggggtctgggcagccaggcatccaccgtgactgagattgtgaagcagcaagac
cccctggtctacaaggccatccagcaaggcatcaatgctgtgaaccaggaagccatgaac
aatgcacagaggattgaaaagtgggtcatcttggagaaggacttttccatctatggtgga
gagctaggtccaatgatgaaacttaagagacattttgtagcccagaaatacaaaaaacaa
attgatcacatgtaccactga

DBGET integrated database retrieval system