KEGG   Homo sapiens (human): 81617Help
Entry
81617             CDS       T01001                                 

Gene name
CAB39L, MO25-BETA, MO2L, bA103J18.3
Definition
(RefSeq) calcium binding protein 39 like
  KO
K08272  calcium binding protein 39
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04152  AMPK signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Environmental Information Processing
  Signal transduction
   04152 AMPK signaling pathway
    81617 (CAB39L)
   04150 mTOR signaling pathway
    81617 (CAB39L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mo25 IFRD HEAT_2 CC2-LZ
Motif
Other DBs
NCBI-GeneID: 81617
NCBI-ProteinID: NP_001073138
OMIM: 612175
HGNC: 20290
Ensembl: ENSG00000102547
Vega: OTTHUMG00000016914
Pharos: Q9H9S4(Tbio)
UniProt: Q9H9S4 A0A024RDT3
Structure
PDB: 

Position
13q14.2
AA seq 337 aa AA seqDB search
MKKMPLFSKSHKNPAEIVKILKDNLAILEKQDKKTDKASEEVSKSLQAMKEILCGTNEKE
PPTEAVAQLAQELYSSGLLVTLIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYIS
AHPHILFMLLKGYEAPQIALRCGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIA
SDAFATFKDLLTRHKVLVADFLEQNYDTIFEDYEKLLQSENYVTKRQSLKLLGELILDRH
NFAIMTKYISKPENLKLMMNLLRDKSPNIQFEAFHVFKVFVASPHKTQPIVEILLKNQPK
LIEFLSSFQKERTDDEQFADEKNYLIKQIRDLKKTAP
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatgcctttgtttagtaaatcacacaaaaatccagcagaaattgtgaaaatc
ctgaaagacaatttggccattttggaaaagcaagacaaaaagacagacaaggcttcagaa
gaagtgtctaaatcactgcaagcaatgaaagaaattctgtgtggtacaaacgagaaagaa
cccccaacagaagcagtggctcagctagcacaagaactctacagcagtggcctgctagtg
acactgatagctgacctgcagctgatagactttgagggaaaaaaagatgtgacccagata
tttaacaacatcttgagaagacagataggcactcggagtcctactgtggagtatattagt
gctcatcctcatatcctgtttatgctcctcaaaggatatgaagccccacagattgcctta
cgttgtgggattatgctgagagaatgtattcgacatgaaccacttgccaaaatcatcctc
ttttctaatcaattcagagatttctttaagtacgtggagttgtcaacatttgatattgct
tcagatgcctttgctactttcaaggatttactaaccagacataaagtgttggtagcagac
ttcttagaacaaaattacgacactatttttgaagactatgagaaattgcttcagtctgag
aattatgttactaagagacagtctttaaagctgctaggggagctgatcctggaccgtcac
aactttgccatcatgacaaagtatatcagcaagccggagaacctgaaactcatgatgaac
ctccttcgggataaaagtcccaacatccagtttgaagcctttcatgtttttaaggtgttt
gtggccagtcctcacaaaacacagcctattgtggagatcctgttaaaaaatcagcccaaa
ctcattgagtttctgagcagcttccaaaaagaaaggacggatgatgagcagttcgctgac
gagaagaactacttgattaaacagatccgagacttgaagaaaacggccccttga

DBGET integrated database retrieval system