KEGG   Homo sapiens (human): 81619Help
Entry
81619             CDS       T01001                                 

Gene name
TSPAN14, DC-TM4F2, TM4SF14
Definition
(RefSeq) tetraspanin 14
  KO
K17296  tetraspanin-14
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    81619 (TSPAN14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   81619 (TSPAN14)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tetraspanin
Motif
Other DBs
NCBI-GeneID: 81619
NCBI-ProteinID: NP_112189
HGNC: 23303
Ensembl: ENSG00000108219
Vega: OTTHUMG00000018615
Pharos: Q8NG11(Tdark)
UniProt: Q8NG11
Position
10q23.1
AA seq 270 aa AA seqDB search
MHYYRYSNAKVSCWYKYLLFSYNIIFWLAGVVFLGVGLWAWSEKGVLSDLTKVTRMHGID
PVVLVLMVGVVMFTLGFAGCVGALRENICLLNFFCGTIVLIFFLELAVAVLAFLFQDWVR
DRFREFFESNIKSYRDDIDLQNLIDSLQKANQCCGAYGPEDWDLNVYFNCSGASYSREKC
GVPFSCCVPDPAQKVVNTQCGYDVRIQLKSKWDESIFTKGCIQALESWLPRNIYIVAGVF
IAISLLQIFGIFLARTLISDIEAVKAGHHF
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgcactattatagatactctaacgccaaggtcagctgctggtacaagtacctccttttc
agctacaacatcatcttctggttggctggagttgtcttccttggagtcgggctgtgggca
tggagcgaaaagggtgtgctgtccgacctcaccaaagtgacccggatgcatggaatcgac
cctgtggtgctggtcctgatggtgggcgtggtgatgttcaccctggggttcgccggctgc
gtgggggctctgcgggagaatatctgcttgctcaactttttctgtggcaccatcgtgctc
atcttcttcctggagctggctgtggccgtgctggccttcctgttccaggactgggtgagg
gaccggttccgggagttcttcgagagcaacatcaagtcctaccgggacgatatcgatctg
caaaacctcatcgactcccttcagaaagctaaccagtgctgtggcgcatatggccctgaa
gactgggacctcaacgtctacttcaattgcagcggtgccagctacagccgagagaagtgc
ggggtccccttctcctgctgcgtgccagatcctgcgcaaaaagttgtgaacacacagtgt
ggatatgatgtcaggattcagctgaagagcaagtgggatgagtccatcttcacgaaaggc
tgcatccaggcgctggaaagctggctcccgcggaacatttacattgtggctggcgtcttc
atcgccatctcgctgttgcagatatttggcatcttcctggcaaggacgctgatctcagac
atcgaggcagtgaaggccggccatcacttctga

DBGET integrated database retrieval system