KEGG   Homo sapiens (human): 81620
Entry
81620             CDS       T01001                                 

Gene name
CDT1, DUP, RIS2
Definition
(RefSeq) chromatin licensing and DNA replication factor 1
  KO
K10727  chromatin licensing and DNA replication factor 1
Organism
hsa  Homo sapiens (human)
Disease
H01889  Meier-Gorlin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    81620 (CDT1)
   03036 Chromosome and associated proteins [BR:hsa03036]
    81620 (CDT1)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   pre-RC (pre-replication complex)
    81620 (CDT1)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     81620 (CDT1)
SSDB
Motif
Pfam: CDT1 CDT1_C
Other DBs
NCBI-GeneID: 81620
NCBI-ProteinID: NP_112190
OMIM: 605525
HGNC: 24576
Ensembl: ENSG00000167513
Vega: OTTHUMG00000173467
Pharos: Q9H211(Tbio)
UniProt: Q9H211
Structure
PDB: 
2WVR 2LE8

Position
16q24.3
AA seq 546 aa
MEQRRVTDFFARRRPGPPRIAPPKLACRTPSPARPALRAPASATSGSRKRARPPAAPGRD
QARPPARRRLRLSVDEVSSPSTPEAPDIPACPSPGQKIKKSTPAAGQPPHLTSAQDQDTI
SELASCLQRARELGARVRALKASAQDAGESCTPEAEGRPEEPCGEKAPAYQRFHALAQPG
LPGLVLPYKYQVLAEMFRSMDTIVGMLHNRSETPTFAKVQRGVQDMMRRRFEECNVGQIK
TVYPASYRFRQERSVPTFKDGTRRSDYQLTIEPLLEQEADGAAPQLTASRLLQRRQIFSQ
KLVEHVKEHHKAFLASLSPAMVVPEDQLTRWHPRFNVDEVPDIEPAALPQPPATEKLTTA
QEVLARARNLISPRMEKALSQLALRSAAPSSPGSPRPALPATPPATPPAASPSALKGVSQ
DLLERIRAKEAQKQLAQMTRCPEQEQRLQRLERLPELARVLRSVFVSERKPALSMEVACA
RMVGSCCTIMSPGEMEKHLLLLSELLPDWLSLHRIRTDTYVKLDKAADLAHITARLAHQT
RAEEGL
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggagcagcgccgcgtcaccgacttcttcgcgcgccgccgccccgggcccccccgcatc
gcgccgcccaagctggcctgccgcacccccagccccgccaggcccgcactccgcgccccg
gcctccgctaccagtggcagccgcaagcgcgcccgcccgcccgccgcccccggacgcgac
caggccaggccaccggcccgcaggagactgcggctgtcggtggacgaggtttccagcccc
agtacccccgaggccccagacatcccagcctgcccttctccgggccagaagataaagaaa
tccaccccggcagcaggtcagccgccccacctgacatccgcgcaggaccaggacaccatc
tctgagcttgcgtcatgcctgcaacgggcccgggagctgggggcaagagtccgggcgctg
aaggccagtgcccaggatgctggggagtcctgcaccccagaggccgagggccgccctgag
gagccatgtggcgagaaggcgcccgcctaccagcgcttccatgccctggcccagcccggc
ctgccgggactcgtgctgccctacaagtaccaggtgctggcggagatgttccgcagcatg
gacaccatcgtgggcatgctccacaaccgctccgagacgcccacctttgccaaggtccag
cggggcgtccaggacatgatgcgtaggcgttttgaggagtgcaatgttggccagatcaaa
accgtgtacccggcctcctaccgcttccgccaggagcgcagtgtccccaccttcaaggat
ggcaccaggaggtcagattaccagctcaccatcgagccactgctggagcaggaggctgac
ggagcagccccccagctcacggcctcgcgcctcctgcagcgacggcagatcttcagccag
aagctggtggagcatgtcaaggagcaccacaaggccttcctggcctccctgagccccgcc
atggtggtgccggaggaccagctgacccgctggcacccgcgcttcaacgtggatgaagta
cccgacatcgagccggccgcgctgccccagccacccgccacggagaagctcaccactgct
caggaggtgctggcccgggcccgcaacctgatttcacccaggatggagaaggccttgagt
caattggccctgcgctctgctgcgcccagcagccccgggtctcccaggccagcactgccg
gctaccccaccagccaccccgcctgcagcctctcccagtgctctgaagggggtgtcccag
gatctgctggagcggatccgagccaaggaggcacagaagcagctggcacagatgacgcgg
tgcccggagcaggagcagcggctgcagcgcttagaacggctgcctgagctggcccgcgtg
ctgcggagcgtctttgtgtccgaacgcaagcctgcgctcagcatggaggtggcctgtgcc
aggatggtgggcagctgttgtactatcatgagccctggggaaatggagaagcacctgctg
ctcctctccgagctgctgccggactggctcagcctccaccgcatccgcaccgacacctac
gtcaagctggacaaggccgcggacctcgcccacatcactgcacgcctggcccaccagaca
cgtgctgaggaggggctgtga

DBGET integrated database retrieval system