KEGG   Homo sapiens (human): 81622
Entry
81622             CDS       T01001                                 

Gene name
UNC93B1, IIAE1, UNC93, UNC93B, Unc-93B1
Definition
(RefSeq) unc-93 homolog B1, TLR signaling regulator
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: UNC-93
Other DBs
NCBI-GeneID: 81622
NCBI-ProteinID: NP_112192
OMIM: 608204
HGNC: 13481
Ensembl: ENSG00000110057
Vega: OTTHUMG00000167472
Pharos: Q9H1C4(Tbio)
UniProt: Q9H1C4
Position
11q13.2
AA seq 597 aa
MEAEPPLYPMAGAAGPQGDEDLLGVPDGPEAPLDELVGAYPNYNEEEEERRYYRRKRLGV
LKNVLAASAGGMLTYGVYLGLLQMQLILHYDETYREVKYGNMGLPDIDSKMLMGINVTPI
AALLYTPVLIRFFGTKWMMFLAVGIYALFVSTNYWERYYTLVPSAVALGMAIVPLWASMG
NYITRMAQKYHEYSHYKEQDGQGMKQRPPRGSHAPYLLVFQAIFYSFFHLSFACAQLPMI
YFLNHYLYDLNHTLYNVQSCGTNSHGILSGFNKTVLRTLPRSGNLIVVESVLMAVAFLAM
LLVLGLCGAAYRPTEEIDLRSVGWGNIFQLPFKHVRDYRLRHLVPFFIYSGFEVLFACTG
IALGYGVCSVGLERLAYLLVAYSLGASAASLLGLLGLWLPRPVPLVAGAGVHLLLTFILF
FWAPVPRVLQHSWILYVAAALWGVGSALNKTGLSTLLGILYEDKERQDFIFTIYHWWQAV
AIFTVYLGSSLHMKAKLAVLLVTLVAAAVSYLRMEQKLRRGVAPRQPRIPRPQHKVRGYR
YLEEDNSDESDAEGEHGDGAEEEAPPAGPRPGPEPAGLGRRPCPYEQAQGGDGPEEQ
NT seq 1794 nt   +upstreamnt  +downstreamnt
atggaggcggagccgccgctctacccgatggcgggggctgcggggccgcagggcgacgag
gacctgctcggggtcccggacgggcccgaggccccgctggacgagctggtgggcgcgtac
cccaactacaacgaggaggaggaggagcgccgctactaccgccgcaagcgcctgggcgtg
ctcaagaacgtgctggctgccagcgccgggggcatgctcacctacggcgtctacctgggc
ctcctgcagatgcagctgatcctgcactacgacgagacctaccgcgaggtgaagtatggc
aacatggggctgcccgacatcgacagcaaaatgctgatgggcatcaacgtgactcccatc
gccgccctgctctacacacctgtgctcatcaggttttttggaacgaagtggatgatgttc
ctcgctgtgggcatctacgccctctttgtctccaccaactactgggagcgctactacacg
cttgtgccctcggctgtggccctgggcatggccatcgtgcctctttgggcttccatgggc
aactacatcaccaggatggcgcagaagtaccatgagtactcccactacaaggagcaggat
gggcaggggatgaagcagcggcctccgcggggctcccacgcgccctatctcctggtcttc
caagccatcttctacagcttcttccatctgagcttcgcctgcgcccagctgcccatgatt
tatttcctgaaccactacctgtatgacctgaaccacacgctgtacaatgtgcagagctgc
ggcaccaacagccacgggatcctcagcggcttcaacaagacggttctgcggacgctcccg
cggagcggaaacctcattgtggtggagagcgtgctcatggcagtggccttcctggccatg
ctgctggtgctgggtttgtgcggagccgcttaccggcccacggaggagatcgatctgcgc
agcgtgggctggggcaacatcttccagctgcccttcaagcacgtgcgtgactaccgcctg
cgccacctcgtgcctttctttatctacagcggcttcgaggtgctctttgcctgcactggt
atcgccttgggctatggcgtgtgctcggtggggctggagcggctggcttacctcctcgtg
gcttacagcctgggcgcctcagccgcctcactcctgggcctgctgggcctgtggctgcca
cgcccggtgcccctggtggccggagcaggggtgcacctgctgctcaccttcatcctcttt
ttctgggcccctgtgcctcgggtcctgcaacacagctggatcctctatgtggcagctgcc
ctttggggtgtgggcagtgccctgaacaagactggactcagcacactcctgggaatcttg
tacgaagacaaggagagacaggacttcatcttcaccatctaccactggtggcaggctgtg
gccatcttcaccgtgtacctgggctcgagcctgcacatgaaggctaagctggcggtgctg
ctggtgacgctggtggcggccgcggtctcctacctgcggatggagcagaagctgcgccgg
ggcgtggccccgcgccagccccgcatcccgcggccccagcacaaggtgcgcggttaccgc
tacttggaggaggacaactcggacgagagcgacgcggagggcgagcatggggacggcgcg
gaggaggaggcgccgcccgcagggcccaggcctggccccgagcccgctggactcggccgc
cggccctgcccgtacgaacaggcgcaggggggagacgggccggaggagcagtga

DBGET integrated database retrieval system