KEGG   Homo sapiens (human): 81623Help
Entry
81623             CDS       T01001                                 

Gene name
DEFB126, C20orf8, DEFB-26, DEFB26, HBD26, bA530N10.1, hBD-26
Definition
(RefSeq) defensin beta 126
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: Defensin_beta_2
Motif
Other DBs
NCBI-GeneID: 81623
NCBI-ProteinID: NP_112193
HGNC: 15900
Ensembl: ENSG00000125788
Vega: OTTHUMG00000031616
Pharos: Q9BYW3(Tbio)
UniProt: Q9BYW3 A0A384MDP8
Position
20p13
AA seq 111 aa AA seqDB search
MKSLLFTLAVFMLLAQLVSGNWYVKKCLNDVGICKKKCKPEEMHVKNGWAMCGKQRDCCV
PADRRANYPVFCVQTKTTRISTVTATTATTTLMMTTASMSSMAPTPVSPTG
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaagtccctactgttcacccttgcagtttttatgctcctggcccaattggtctcaggt
aattggtatgtgaaaaagtgtctaaacgacgttggaatttgcaagaagaagtgcaaacct
gaagagatgcatgtaaagaatggttgggcaatgtgcggcaaacaaagggactgctgtgtt
ccagctgacagacgtgctaattatcctgttttctgtgtccagacaaagactacaagaatt
tcaacagtaacagcaacaacagcaacaacaactttgatgatgactactgcttcgatgtct
tcgatggctcctacccccgtttctcccactggttga

DBGET integrated database retrieval system