KEGG   Homo sapiens (human): 81629Help
Entry
81629             CDS       T01001                                 

Gene name
TSSK3, SPOGA3, STK22C, STK22D, TSK3
Definition
(RefSeq) testis specific serine kinase 3
  KO
K08811  testis-specific serine kinase [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Brite
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     81629 (TSSK3)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  TSSK family
   81629 (TSSK3)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    81629 (TSSK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Rdx
Motif
Other DBs
NCBI-GeneID: 81629
NCBI-ProteinID: NP_443073
OMIM: 607660
HGNC: 15473
Ensembl: ENSG00000162526
Vega: OTTHUMG00000007585
Pharos: Q96PN8(Tbio)
UniProt: Q96PN8
Position
1p35.1
AA seq 268 aa AA seqDB search
MEDFLLSNGYQLGKTIGEGTYSKVKEAFSKKHQRKVAIKVIDKMGGPEEFIQRFLPRELQ
IVRTLDHKNIIQVYEMLESADGKICLVMELAEGGDVFDCVLNGGPLPESRAKALFRQMVE
AIRYCHGCGVAHRDLKCENALLQGFNLKLTDFGFAKVLPKSHRELSQTFCGSTAYAAPEV
LQGIPHDSKKGDVWSMGVVLYVMLCASLPFDDTDIPKMLWQQQKGVSFPTHLSISADCQD
LLKRLLEPDMILRPSIEEVSWHPWLAST
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atggaggactttctgctctccaatgggtaccagctgggcaagaccattggggaagggacc
tactcaaaagtcaaagaagcattttccaaaaaacaccaaagaaaagtggcaattaaagtt
atagacaagatgggagggccagaagagtttatccagagattcctccctcgggagctccaa
atcgtccgtaccctggaccacaagaacatcatccaggtgtatgagatgctggagtctgcc
gacgggaaaatctgcctggtgatggagctcgctgagggaggggatgtctttgactgcgtg
ctgaatggggggccactgcctgaaagccgggccaaggccctcttccgtcagatggttgag
gccatccgctactgccatggctgtggtgtggcccaccgggacctcaaatgtgagaacgcc
ttgttgcagggcttcaacctgaagctgactgactttggctttgccaaggtgttgcccaag
tcacaccgggagctgagccagaccttctgcggcagtacagcctatgctgcccccgaggtg
ctgcagggcattccccacgatagcaaaaaaggtgatgtctggagcatgggtgtggtcctg
tatgtcatgctctgtgccagcctaccttttgacgacacagacatccccaagatgctgtgg
cagcagcagaagggggtgtccttccccactcatctgagcatctcggccgattgccaggac
ctgctcaagaggctcctggaacccgatatgatcctccggccttcaattgaagaagttagt
tggcatccatggctagcaagcacttga

DBGET integrated database retrieval system