KEGG   Homo sapiens (human): 8165Help
Entry
8165              CDS       T01001                                 

Gene name
AKAP1, AKAP, AKAP121, AKAP149, AKAP84, D-AKAP1, PPP1R43, PRKA1, SAKAP84, TDRD17
Definition
(RefSeq) A-kinase anchoring protein 1
  KO
K16518  A-kinase anchor protein 1, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8165 (AKAP1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8165 (AKAP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TUDOR KH_1 RII_binding_1 DUF3552 Agenet
Motif
Other DBs
NCBI-GeneID: 8165
NCBI-ProteinID: NP_001229831
OMIM: 602449
HGNC: 367
Ensembl: ENSG00000121057
Vega: OTTHUMG00000140369
Pharos: Q92667(Tbio)
UniProt: Q92667 B4DN86 A0A140VK05
Position
17q22
AA seq 903 aa AA seqDB search
MAIQFRSLFPLALPGMLALLGWWWFFSRKKGHVSSHDEQQVEAGAVQLRADPAIKEPLPV
EDVCPKVVSTPPSVTEPPEKELSTVSKLPAEPPALLQTHPPCRRSESSGILPNTTDMRLR
PGTRRDDSTKLELALTGGEAKSIPLECPLSSPKGVLFSSKSAEVCKQDSPFSRVPRKVQP
GYPVVPAEKRSSGERARETGGAEGTGDAVLGEKVLEEALLSREHVLELENSKGPSLASLE
GEEDKGKSSSSQVVGPVQEEEYVAEKLPSRFIESAHTELAKDDAAPAPPVADAKAQDRGV
EGELGNEESLDRNEEGLDRNEEGLDRNEESLDRNEEGLDRNEEIKRAAFQIISQVISEAT
EQVLATTVGKVAGRVCQASQLQGQKEESCVPVHQKTVLGPDTAEPATAEAAVAPPDAGLP
LPGLPAEGSPPPKTYVSCLKSLLSSPTKDSKPNISAHHISLASCLALTTPSEELPDRAGI
LVEDATCVTCMSDSSQSVPLVASPGHCSDSFSTSGLEDSCTETSSSPRDKAITPPLPEST
VPFSNGVLKGELSDLGAEDGWTMDAEADHSGGSDRNSMDSVDSCCSLKKTESFQNAQAGS
NPKKVDLIIWEIEVPKHLVGRLIGKQGRYVSFLKQTSGAKIYISTLPYTQSVQICHIEGS
QHHVDKALNLIGKKFKELNLTNIYAPPLPSLALPSLPMTSWLMLPDGITVEVIVVNQVNA
GHLFVQQHTHPTFHALRSLDQQMYLCYSQPGIPTLPTPVEITVICAAPGADGAWWRAQVV
ASYEETNEVEIRYVDYGGYKRVKVDVLRQIRSDFVTLPFQGAEVLLDSVMPLSDDDQFSP
EADAAMSEMTGNTALLAQVTSYSPTGLPLIQLWSVVGDEVVLINRSLVERGLAQWVDSYY
TSL
NT seq 2712 nt NT seq  +upstreamnt  +downstreamnt
atggcaatccagttccgttcgctcttccccttggcattgcctgggatgctggcgctcctc
ggctggtggtggtttttctctcgtaaaaaaggccatgtcagcagccatgatgagcagcag
gtggaggctggtgctgtgcagctgagggctgaccctgccatcaaggaacctctccccgtg
gaagacgtctgtcccaaagtagtgtccacaccccccagtgtcacagagcctccagaaaag
gaactgtccaccgtgagcaagctgcctgcagagcccccagcattgctccagacacaccca
ccttgccgaagatcagagtcctcgggcattcttcctaacaccacagacatgagattgcga
ccaggaacacgcagagatgacagtacaaagctggagctagccctgacaggtggtgaagcc
aaatcgattcctctagagtgccccctttcatccccaaagggtgtactattctccagcaaa
tcagctgaggtgtgtaagcaagattcccccttcagcagggtgccaaggaaggtccagcca
ggctaccccgtagtccccgcagagaagcgtagctctggggagagggcaagagagacaggt
ggggccgaagggactggtgatgccgtgttgggggaaaaggtgcttgaagaagctctgttg
tctcgggagcatgtcttggaattggagaacagcaagggccccagcctggcctctttagag
ggggaagaagataaggggaagagcagctcatcccaggtggtggggccagtgcaggaggaa
gagtatgtagcagagaagttgccaagtaggttcatcgagtcggctcacacagagctggca
aaggacgatgcggcgccagcacccccagtcgcagacgccaaagcccaggatagaggtgtc
gagggagaactgggcaatgaggagagcttggatagaaatgaggagggcttggatagaaat
gaggagggcttggatagaaatgaggagagcttggatagaaatgaggagggcttggataga
aatgaggagattaagcgggctgccttccagataatctcccaagtgatctcagaagcaacc
gaacaggtgctggccaccacggttggcaaggttgcaggtcgtgtgtgtcaggccagtcag
ctccaagggcagaaggaagagagctgtgtcccagttcaccagaaaactgtcttgggccca
gacactgcggagcctgccacagcagaggcagctgttgccccgccggatgctggcctcccc
ttgccaggcctaccagcagagggctcaccaccaccaaagacctacgtgagctgcctgaag
agccttctgtccagccccaccaaggacagtaagccaaatatctctgcacaccacatctcc
ctggcctcctgcctggcactgaccacccccagtgaagagttgccggaccgggcaggcatc
ctggtggaagatgccacctgtgtcacctgcatgtcagacagcagccaaagtgtccctttg
gtggcttctccaggacactgctcagattctttcagcacttcagggcttgaagactcttgc
acagagaccagctcgagccccagggacaaggccatcaccccgccactgccagaaagtact
gtgcccttcagcaatggggtgctgaagggggagttgtcagacttgggggctgaggatgga
tggaccatggatgcggaagcagatcattcaggaggttctgacaggaacagcatggattcc
gtggatagctgttgcagtctcaagaagactgagagcttccaaaatgcccaggcaggctcc
aaccctaagaaggtcgacctcatcatctgggagatcgaggtgccaaagcacttagtcggt
cggctaattggcaagcaggggcgctatgtgagttttctgaagcaaacatctggtgccaag
atctacatttcaaccctgccttacacccagagcgtccagatctgccacatagaaggctct
caacatcatgtagacaaagcgctgaacttgattgggaagaagttcaaagagctgaacctc
accaatatctacgctcccccattgccttcactggcactgccttctctgccgatgacatcc
tggctcatgctgcctgatggcatcaccgtggaggtcattgtggtcaaccaggtcaatgcc
gggcacctgttcgtgcagcagcacacacaccctaccttccacgcgctgcgcagcctcgac
cagcagatgtacctctgttactctcagcctggaatccccaccttgcccaccccagtggaa
ataacggtcatctgtgccgcccctggtgcggacggggcctggtggcgagcccaagtggtt
gcctcctacgaggagaccaacgaagtggagattcgatacgtggactacggcggatataag
agggtgaaagtagacgtgctccggcaaatcaggtctgactttgtcaccctgccgtttcag
ggagcagaagtccttctggacagtgtgatgcccctgtcagacgatgaccagttttcaccg
gaagcagatgccgccatgagcgagatgacggggaatacagcactgcttgctcaggtgaca
agttacagtccaactggtcttcctctgattcagctgtggagtgtggttggagatgaagtg
gtgttgataaaccggtccctggtggagcgaggccttgcccagtgggtagacagctactac
acaagcctttga

DBGET integrated database retrieval system