KEGG   Homo sapiens (human): 81693Help
Entry
81693             CDS       T01001                                 

Gene name
AMN, PRO1028, amnionless
Definition
(RefSeq) amnion associated transmembrane protein
  KO
K18259  protein amnionless
Organism
hsa  Homo sapiens (human)
Disease
H01277  Vitamin B12 deficiency anaemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    81693 (AMN)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   81693 (AMN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Amnionless
Motif
Other DBs
NCBI-GeneID: 81693
NCBI-ProteinID: NP_112205
OMIM: 605799
HGNC: 14604
Ensembl: ENSG00000166126
Vega: OTTHUMG00000171897
Pharos: Q9BXJ7(Tbio)
UniProt: Q9BXJ7
Structure
PDB: 

Position
14q32.32
AA seq 453 aa AA seqDB search
MGVLGRVLLWLQLCALTQAVSKLWVPNTDFDVAANWSQNRTPCAGGAVEFPADKMVSVLV
QEGHAVSDMLLPLDGELVLASGAGFGVSDVGSHLDCGAGEPAVFRDSDRFSWHDPHLWRS
GDEAPGLFFVDAERVPCRHDDVFFPPSASFRVGLGPGASPVRVRSISALGRTFTRDEDLA
VFLASRAGRLRFHGPGALSVGPEDCADPSGCVCGNAEAQPWICAALLQPLGGRCPQAACH
SALRPQGQCCDLCGAVVLLTHGPAFDLERYRARILDTFLGLPQYHGLQVAVSKVPRSSRL
READTEIQVVLVENGPETGGAGRLARALLADVAENGEALGVLEATMRESGAHVWGSSAAG
LAGGVAAAVLLALLVLLVAPPLLRRAGRLRWRRHEAAAPAGAPLGFRNPVFDVTASEELP
LPRRLSLVPKAAADSTSHSYFVNPLFAGAEAEA
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgggcgtcctgggccgggtcctgctgtggctgcagctctgcgcactgacccaggcggtc
tccaaactctgggtccccaacacggacttcgacgtcgcagccaactggagccagaaccgg
accccgtgcgccggcggcgccgttgagttcccggcggacaagatggtgtcagtcctggtg
caagaaggtcacgccgtctcagacatgctcctgccgctggatggggaactcgtcctggct
tcaggagccggattcggcgtctcagacgtgggctcgcacctggactgtggcgcgggcgaa
cctgccgtcttccgcgactctgaccgcttctcctggcatgacccgcacctgtggcgctct
ggggacgaggcacctggcctcttcttcgtggacgccgagcgcgtgccctgccgccacgac
gacgtcttctttccgcctagtgcctccttccgcgtggggctcggccctggcgctagcccc
gtgcgtgtccgcagcatctcggctctgggccggacgttcacgcgcgacgaggacctggct
gttttcctggcgtcccgcgcgggccgcctacgcttccacgggccgggcgcgctgagcgtg
ggccccgaggactgcgcggacccgtcgggctgcgtctgcggcaacgcggaggcgcagccg
tggatctgcgcggccctgctccagcccctgggcggccgctgcccccaggccgcctgccac
agcgccctccggccccaggggcagtgctgtgacctctgtggagccgttgtgttgctgacc
cacggccccgcatttgacctggagcggtaccgggcgcggatactggacaccttcctgggt
ctgcctcagtaccacgggctgcaggtggccgtgtccaaggtgccacgctcgtcccggctc
cgtgaggccgatacggagatccaggtggtgctggtggagaatgggcccgagacaggcgga
gcggggcggctggcccgggccctcctggcggacgtcgccgagaacggcgaggccctcggc
gtcctggaggcgaccatgcgggagtcgggcgcacacgtctggggcagctccgcggctggg
ctggcgggcggcgtggcggctgccgtgctgctggcgctgctggtcctgctggtggcgccg
ccgctgctgcgccgcgcggggaggctcaggtggaggaggcacgaggcggcggccccggct
ggagcgcccctcggcttccgcaacccggtgttcgacgtgacggcctccgaggagctgccc
ctgccgcggcggctcagcctggttccgaaggcggccgcagacagcaccagccacagttac
ttcgtcaaccctctgttcgccggggccgaggccgaggcctga

DBGET integrated database retrieval system