KEGG   Homo sapiens (human): 8170Help
Entry
8170              CDS       T01001                                 

Gene name
SLC14A2, HUT2, UT-A2, UT2, UTA, UTR, hUT-A6
Definition
(RefSeq) solute carrier family 14 member 2
  KO
K08716  solute carrier family 14 (urea transporter)
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8170 (SLC14A2)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC14: Urea transporter
   8170 (SLC14A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: UT
Motif
Other DBs
NCBI-GeneID: 8170
NCBI-ProteinID: NP_001229621
OMIM: 601611
HGNC: 10919
Ensembl: ENSG00000132874
Vega: OTTHUMG00000132616
Pharos: Q15849(Tbio)
UniProt: Q15849
Position
18q12.3
AA seq 920 aa AA seqDB search
MSDPHSSPLLPEPLSSRYKLYEAEFTSPSWPSTSPDTHPALPLLEMPEEKDLRSSNEDSH
IVKIEKLNERSKRKDDGVAHRDSAGQRCICLSKAVGYLTGDMKEYRIWLKDKHLALQFID
WVLRGTAQVMFINNPLSGLIIFIGLLIQNPWWTITGGLGTVVSTLTALALGQDRSAIASG
LHGYNGMLVGLLMAVFSEKLDYYWWLLFPVTFTAMSCPVLSSALNSIFSKWDLPVFTLPF
NIAVTLYLAATGHYNLFFPTTLVEPVSSVPNITWTEMEMPLLLQAIPVGVGQVYGCDNPW
TGGVFLVALFISSPLICLHAAIGSIVGLLAALSVATPFETIYTGLWSYNCVLSCIAIGGM
FYALTWQTHLLALICALFCAYMEAAISNIMSVVGVPPGTWAFCLATIIFLLLTTNNPAIF
RLPLSKVTYPEANRIYYLTVKSGEEEKAPSGGGGEHPPTAGPKVEEGSEAVLSKHRSVFH
IEWSSIRRRSKVFGKGEHQERQNKDPFPYRYRKPTVELLDLDTMEESSEIKVETNISKTS
WIRSSMAASGKRVSKALSYITGEMKECGEGLKDKSPVFQFFDWVLRGTSQVMFVNNPLSG
ILIILGLFIQNPWWAISGCLGTIMSTLTALILSQDKSAIAAGFHGYNGVLVGLLMAVFSD
KGDYYWWLLLPVIIMSMSCPILSSALGTIFSKWDLPVFTLPFNITVTLYLAATGHYNLFF
PTTLLQPASAMPNITWSEVQVPLLLRAIPVGIGQVYGCDNPWTGGIFLIALFISSPLICL
HAAIGSTMGMLAALTIATPFDSIYFGLCGFNSTLACIAIGGMFYVITWQTHLLAIACALF
AAYLGAALANMLSVFGLPPCTWPFCLSALTFLLLTTNNPAIYKLPLSKVTYPEANRIYYL
SQERNRRASIITKYQAYDVS
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacccccacagcagtcctctcctgccagagccactttccagcagatacaaactc
tacgaggcagagtttaccagcccgagctggccctcgacatccccggatactcacccagct
ctgcccctcctggaaatgcctgaagaaaaggatctccggtcttccaatgaagacagtcac
attgtgaagatcgaaaagctcaatgaaaggagtaaaaggaaagacgacggggtggcccat
cgggactcagcaggccaaaggtgcatctgcctctccaaagcagtgggctacctcacgggc
gacatgaaggagtacaggatctggctgaaagacaagcaccttgccctccagttcatagac
tgggtcctgagagggaccgctcaggtgatgttcatcaacaatcctctcagcggcctcatc
atcttcatagggctgctgatccagaatccctggtggacaatcactgggggcctggggaca
gtggtctcgaccttaacagctctcgccttgggccaagacaggtctgccattgcctcagga
ctccatgggtacaacgggatgctggtgggactgctgatggccgtgttctcggagaagtta
gactactactggtggcttctgtttcctgtgaccttcacagccatgtcctgcccagttctt
tctagtgccttgaattccatcttcagcaagtgggacctcccggtcttcactctgcccttc
aacattgcagtcaccttgtaccttgcagccacaggccactacaacctcttcttccccaca
acactggtagagcctgtgtcttcagtgcccaatatcacctggacagagatggaaatgccc
ctgctgttacaagccatccctgttggggtcggccaggtgtatggctgtgacaatccctgg
acaggcggcgtgttcctggtggctctgttcatctcctcgccactcatctgcttgcatgca
gccattggctcaatcgtggggctgctagcagccctgtcagtggccacacccttcgagacc
atctacacaggcctctggagctacaactgcgtcctctcctgcatcgccatcggaggcatg
ttctatgccctcacctggcagactcacctgctggccctcatctgtgccctgttctgtgca
tacatggaagcagccatctccaacatcatgtcagtggtgggcgtgccaccaggcacctgg
gccttctgccttgccaccatcatcttcctgctcctgacgacaaacaacccagccatcttc
agactcccactcagcaaagtcacctaccccgaggccaaccgcatctactacctgacagtg
aaaagcggtgaagaagagaaggcccccagcggaggcggtggggagcatccacccacagca
ggcccaaaggtggaggagggctcggaggctgtgctctccaagcacaggagtgtatttcac
atcgagtggtcatccattcggaggaggagcaaagtgtttggaaaaggcgaacaccaggaa
agacaaaacaaagacccatttccctatcgataccggaagcccacagtcgagctgcttgat
ctggacaccatggaggagagctctgagataaaagtggaaacaaacatttccaagacatcc
tggattcggagttccatggctgccagtgggaaaagggtcagcaaagccctcagctacatc
acaggagagatgaaggagtgtggagagggacttaaagacaagtccccagtgttccagttc
tttgactgggtcctccgaggcacatctcaagtgatgtttgtgaacaaccccctcagcggc
atcctcatcatcctcggcctcttcatccagaacccctggtgggcgatctcaggctgcctg
ggtaccatcatgtccaccttgacagccctcatcctgagtcaggacaagtcggccatcgct
gcaggatttcacggctacaatggggtgctggtggggctgctgatggccgtgttctcagac
aaaggtgactactactggtggctgttgctacccgtcatcatcatgtccatgtcttgcccc
atcctctccagtgccctgggtaccatcttcagcaagtgggacctcccagtcttcacactg
cccttcaatatcactgtgactttgtacctggcagccacgggccactacaaccttttcttc
cccacaacgctgctgcagcctgcatccgccatgcccaacatcacctggtcagaggtccaa
gtgcccttgcttttgagagccatccccgttggaattggccaagtgtacggctgtgataac
ccctggactggaggcatcttcctcatagctctgttcatatcctcacctctcatttgcttg
catgcagcaattggatccaccatggggatgctagcagcactcactattgcgacgcccttt
gactccatctacttcggcctgtgtggcttcaacagcaccctcgcatgcatagcgatagga
ggcatgttctacgtcatcacctggcagacgcacctcctcgccatcgcctgcgcactgttt
gctgcctacctgggtgctgccctggctaacatgttatctgtgtttggattgccgccctgc
acttggcccttctgtctctcagctctcaccttcctgctcctgacgaccaataaccccgcc
atctacaagctcccgctcagcaaagtcacctacccagaggccaaccgcatctactacctg
tcccaggagagaaacagaagggcatcaatcataacaaagtatcaggcctacgatgtctcc
taa

DBGET integrated database retrieval system