KEGG   Homo sapiens (human): 8174Help
Entry
8174              CDS       T01001                                 

Gene name
MADCAM1, MACAM1
Definition
(RefSeq) mucosal vascular addressin cell adhesion molecule 1
  KO
K06779  mucosal vascular addressin cell adhesion molecule 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04514  Cell adhesion molecules (CAMs)
hsa04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    8174 (MADCAM1)
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    8174 (MADCAM1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Adhes-Ig_like Ig_3 ig ICAM_N
Motif
Other DBs
NCBI-GeneID: 8174
NCBI-ProteinID: NP_570116
OMIM: 102670
HGNC: 6765
Ensembl: ENSG00000099866
Vega: OTTHUMG00000180548
Pharos: Q13477(Tbio)
UniProt: Q13477
Structure
PDB: 

Position
19p13.3
AA seq 382 aa AA seqDB search
MDFGLALLLAGLLGLLLGQSLQVKPLQVEPPEPVVAVALGASRQLTCRLACADRGASVQW
RGLDTSLGAVQSDTGRSVLTVRNASLSAAGTRVCVGSCGGRTFQHTVQLLVYAFPDQLTV
SPAALVPGDPEVACTAHKVTPVDPNALSFSLLVGGQELEGAQALGPEVQEEEEEPQGDED
VLFRVTERWRLPPLGTPVPPALYCQATMRLPGLELSHRQAIPVLHSPTSPEPPDTTSPES
PDTTSPESPDTTSQEPPDTTSPEPPDKTSPEPAPQQGSTHTPRSPGSTRTRRPEISQAGP
TQGEVIPTGSSKPAGDQLPAALWTSSAVLGLLLLALPTYHLWKRCRHLAEDDTHPPASLR
LLPQVSAWAGLRGTGQVGISPS
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atggatttcggactggccctcctgctggcggggcttctggggctcctcctcggccagtcc
ctccaggtgaagcccctgcaggtggagcccccggagccggtggtggccgtggccttgggc
gcctcgcgccagctcacctgccgcctggcctgcgcggaccgcggggcctcggtgcagtgg
cggggcctggacaccagcctgggcgcggtgcagtcggacacgggccgcagcgtcctcacc
gtgcgcaacgcctcgctgtcggcggccgggacccgcgtgtgcgtgggctcctgcgggggc
cgcaccttccagcacaccgtgcagctccttgtgtacgccttcccggaccagctgaccgtc
tccccagcagccctggtgcctggtgacccggaggtggcctgtacggcccacaaagtcacg
cccgtggaccccaacgcgctctccttctccctgctcgtcgggggccaggaactggagggg
gcgcaagccctgggcccggaggtgcaggaggaggaggaggagccccagggggacgaggac
gtgctgttcagggtgacagagcgctggcggctgccgcccctggggacccctgtcccgccc
gccctctactgccaggccacgatgaggctgcctggcttggagctcagccaccgccaggcc
atccccgtcctgcacagcccgacctccccggagcctcccgacaccacctccccggagtct
cccgacaccacctccccggagtctcccgacaccacctcccaggagcctcccgacaccacc
tccccggagcctcccgacaagacctccccggagcccgccccccagcagggctccacacac
acccccaggagcccaggctccaccaggactcgccgccctgagatctcccaggctgggccc
acgcagggagaagtgatcccaacaggctcgtccaaacctgcgggtgaccagctgcccgcg
gctctgtggaccagcagtgcggtgctgggactgctgctcctggccttgcccacctatcac
ctctggaaacgctgccggcacctggctgaggacgacacccacccaccagcttctctgagg
cttctgccccaggtgtcggcctgggctgggttaagggggaccggccaggtcgggatcagc
ccctcctga

DBGET integrated database retrieval system