KEGG   Homo sapiens (human): 81792
Entry
81792             CDS       T01001                                 
Symbol
ADAMTS12, PRO4389
Name
(RefSeq) ADAM metallopeptidase with thrombospondin type 1 motif 12
  KO
K08626  a disintegrin and metalloproteinase with thrombospondin motifs 12 [EC:3.4.24.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    81792 (ADAMTS12)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.-
     81792 (ADAMTS12)
Peptidases and inhibitors [BR:hsa01002]
 Metallo peptidases
  Family M12: astacin/adamalysin family
   81792 (ADAMTS12)
SSDB
Motif
Pfam: TSP1_ADAMTS TSP_1 Pep_M12B_propep ADAMTS_spacer1 Reprolysin ADAMTS_CR_2 TSP1_CCN Reprolysin_5 ADAMTS_CR_3 TSP1_spondin Reprolysin_3 Reprolysin_2 Reprolysin_4
Other DBs
NCBI-GeneID: 81792
NCBI-ProteinID: NP_112217
OMIM: 606184
HGNC: 14605
Ensembl: ENSG00000151388
Pharos: P58397(Tbio)
UniProt: P58397
Position
5:complement(33523535..33891990)
AA seq 1594 aa
MPCAQRSWLANLSVVAQLLNFGALCYGRQPQPGPVRFPDRRQEHFIKGLPEYHVVGPVRV
DASGHFLSYGLHYPITSSRRKRDLDGSEDWVYYRISHEEKDLFFNLTVNQGFLSNSYIME
KRYGNLSHVKMMASSAPLCHLSGTVLQQGTRVGTAALSACHGLTGFFQLPHGDFFIEPVK
KHPLVEGGYHPHIVYRRQKVPETKEPTCGLKDSVNISQKQELWREKWERHNLPSRSLSRR
SISKERWVETLVVADTKMIEYHGSENVESYILTIMNMVTGLFHNPSIGNAIHIVVVRLIL
LEEEEQGLKIVHHAEKTLSSFCKWQKSINPKSDLNPVHHDVAVLLTRKDICAGFNRPCET
LGLSHLSGMCQPHRSCNINEDSGLPLAFTIAHELGHSFGIQHDGKENDCEPVGRHPYIMS
RQLQYDPTPLTWSKCSEEYITRFLDRGWGFCLDDIPKKKGLKSKVIAPGVIYDVHHQCQL
QYGPNATFCQEVENVCQTLWCSVKGFCRSKLDAAADGTQCGEKKWCMAGKCITVGKKPES
IPGGWGRWSPWSHCSRTCGAGVQSAERLCNNPEPKFGGKYCTGERKRYRLCNVHPCRSEA
PTFRQMQCSEFDTVPYKNELYHWFPIFNPAHPCELYCRPIDGQFSEKMLDAVIDGTPCFE
GGNSRNVCINGICKMVGCDYEIDSNATEDRCGVCLGDGSSCQTVRKMFKQKEGSGYVDIG
LIPKGARDIRVMEIEGAGNFLAIRSEDPEKYYLNGGFIIQWNGNYKLAGTVFQYDRKGDL
EKLMATGPTNESVWIQLLFQVTNPGIKYEYTIQKDGLDNDVEQQMYFWQYGHWTECSVTC
GTGIRRQTAHCIKKGRGMVKATFCDPETQPNGRQKKCHEKACPPRWWAGEWEACSATCGP
HGEKKRTVLCIQTMVSDEQALPPTDCQHLLKPKTLLSCNRDILCPSDWTVGNWSECSVSC
GGGVRIRSVTCAKNHDEPCDVTRKPNSRALCGLQQCPSSRRVLKPNKGTISNGKNPPTLK
PVPPPTSRPRMLTTPTGPESMSTSTPAISSPSPTTASKEGDLGGKQWQDSSTQPELSSRY
LISTGSTSQPILTSQSLSIQPSEENVSSSDTGPTSEGGLVATTTSGSGLSSSRNPITWPV
TPFYNTLTKGPEMEIHSGSGEEREQPEDKDESNPVIWTKIRVPGNDAPVESTEMPLAPPL
TPDLSRESWWPPFSTVMEGLLPSQRPTTSETGTPRVEGMVTEKPANTLLPLGGDHQPEPS
GKTANRNHLKLPNNMNQTKSSEPVLTEEDATSLITEGFLLNASNYKQLTNGHGSAHWIVG
NWSECSTTCGLGAYWRRVECSTQMDSDCAAIQRPDPAKRCHLRPCAGWKVGNWSKCSRNC
SGGFKIREIQCVDSRDHRNLRPFHCQFLAGIPPPLSMSCNPEPCEAWQVEPWSQCSRSCG
GGVQERGVFCPGGLCDWTKRPTSTMSCNEHLCCHWATGNWDLCSTSCGGGFQKRTVQCVP
SEGNKTEDQDQCLCDHKPRPPEFKKCNQQACKKSADLLCTKDKLSASFCQTLKAMKKCSV
PTVRAECCFSCPQTHITHTQRQRRQRLLQKSKEL
NT seq 4785 nt   +upstreamnt  +downstreamnt
atgccatgtgcccagaggagctggcttgcaaacctttccgtggtggctcagctccttaac
tttggggcgctttgctatgggagacagcctcagccaggcccggttcgcttcccggacagg
aggcaagagcattttatcaagggcctgccagaataccacgtggtgggtccagtccgagta
gatgccagtgggcattttttgtcatatggcttgcactatcccatcacgagcagcaggagg
aagagagatttggatggctcagaggactgggtgtactacagaatttctcacgaggagaag
gacctgttttttaacttgacggtcaatcaaggatttctttccaatagctacatcatggag
aagagatatgggaacctctcccatgttaagatgatggcttcctctgcccccctctgccat
ctcagtggcacggttctacagcagggcaccagagttgggacggcagccctcagtgcctgc
catggactgactggatttttccaactaccacatggagactttttcattgaacccgtgaag
aagcatccactggttgagggagggtaccacccgcacatcgtttacaggaggcagaaagtt
ccagaaaccaaggagccaacctgtggattaaaggacagtgttaacatctcccagaagcaa
gagctatggcgggagaagtgggagaggcacaacttgccaagcagaagcctctctcggcgt
tccatcagcaaggagagatgggtggagacactggtggtggccgacacaaagatgattgaa
taccatgggagtgagaatgtggagtcctacatcctcaccatcatgaacatggtcactggg
ttgttccataacccaagcattggcaatgcaattcacattgttgtggttcggctcattcta
ctcgaagaagaagagcaaggactgaaaatagttcaccatgcagaaaagacactgtctagc
ttctgcaagtggcagaagagtatcaatcccaagagtgacctcaatcctgttcatcacgac
gtggctgtccttctcaccagaaaggacatctgtgctggtttcaatcgcccctgcgagacc
ctgggcctgtctcacctttcaggaatgtgtcagcctcaccgcagttgtaacatcaatgaa
gattcgggactccctctggctttcacaattgcccatgagctaggacacagcttcggcatc
cagcatgatgggaaagaaaatgactgtgagcctgtgggcagacatccgtacatcatgtcc
cgccagctccagtacgatcccactccgctgacatggtccaagtgcagcgaggagtacatc
acccgcttcttggaccgaggctgggggttctgtcttgatgacatacctaaaaagaaaggc
ttgaagtccaaggtcattgcccccggagtgatctatgatgttcaccaccagtgccagcta
caatatggacccaatgctaccttctgccaggaagtagaaaacgtctgccagacactgtgg
tgctccgtgaagggcttttgtcgctctaagctggacgctgctgcagatggaactcaatgt
ggtgagaagaagtggtgtatggcaggcaagtgcatcacagtggggaagaaaccagagagc
attcctggaggctggggccgctggtcaccctggtcccactgttccaggacctgtggggct
ggagtccagagcgcagagaggctctgcaacaaccccgagccaaagtttggagggaaatat
tgcactggagaaagaaaacgctatcgcttgtgcaacgtccacccctgtcgctcagaggca
ccaacatttcggcagatgcagtgcagtgaatttgacactgttccctacaagaatgaactc
taccactggtttcccatttttaacccagcacatccttgtgagctctactgccgacccata
gatggccagttttctgagaaaatgctggatgctgtcattgatggtaccccttgctttgaa
ggcggcaacagcagaaatgtctgtattaatggcatatgtaagatggttggctgtgactat
gagatcgattccaatgccaccgaggatcgctgcggtgtgtgcctgggagatggctcttcc
tgccagactgtgagaaagatgtttaagcagaaggaaggatctggttatgttgacattggg
ctcattccaaaaggagcaagggacataagagtgatggaaattgagggagctggaaacttc
ctggccatcaggagtgaagatcctgaaaaatattacctgaatggagggtttattatccag
tggaacgggaactataagctggcagggactgtctttcagtatgacaggaaaggagacctg
gaaaagctgatggccacaggtcccaccaatgagtctgtgtggatccagcttctattccag
gtgactaaccctggcatcaagtatgagtacacaatccagaaagatggccttgacaatgat
gttgagcagcagatgtacttctggcagtacggccactggacagagtgcagtgtgacctgc
gggacaggtatccgccgccaaactgcccattgcataaagaagggccgcgggatggtgaaa
gctacattctgtgacccagaaacacagcccaatgggagacagaagaagtgccatgaaaag
gcttgtccacccaggtggtgggcaggggagtgggaagcatgctcggcgacatgcgggccc
cacggggagaagaagcgaaccgtgctgtgcatccagaccatggtctctgacgagcaggct
ctcccgcccacagactgccagcacctgctgaagcccaagaccctcctttcctgcaacaga
gacatcctgtgcccctcggactggacagtgggcaactggagtgagtgttctgtttcctgt
ggtggtggagtgcggattcgcagtgtcacatgtgccaagaaccatgatgaaccttgcgat
gtgacaaggaaacccaacagccgagctctgtgtggcctccagcaatgcccttctagccgg
agagttctgaaaccaaacaaaggcactatttccaatggaaaaaacccaccaacactaaag
cccgtccctccacctacatccaggcccagaatgctgaccacacccacagggcctgagtct
atgagcacaagcactccagcaatcagcagccctagtcctaccacagcctccaaagaagga
gacctgggtgggaaacagtggcaagatagctcaacccaacctgagctgagctctcgctat
ctcatttccactggaagcacttcccagcccatcctcacttcccaatccttgagcattcag
ccaagtgaggaaaatgtttccagttcagatactggtcctacctcggagggaggccttgta
gctacaacaacaagtggttctggcttgtcatcttcccgcaaccctatcacttggcctgtg
actccattttacaataccttgaccaaaggtccagaaatggagattcacagtggctcaggg
gaagaaagagaacagcctgaggacaaagatgaaagcaatcctgtaatatggaccaagatc
agagtacctggaaatgacgctccagtggaaagtacagaaatgccacttgcacctccacta
acaccagatctcagcagggagtcctggtggccacccttcagcacagtaatggaaggactg
ctccccagccaaaggcccactacttccgaaactgggacacccagagttgaggggatggtt
actgaaaagccagccaacactctgctccctctgggaggagaccaccagccagaaccctca
ggaaagacggcaaaccgtaaccacctgaaacttccaaacaacatgaaccaaacaaaaagt
tctgaaccagtcctgactgaggaggatgcaacaagtctgattactgagggctttttgcta
aatgcctccaattacaagcagctcacaaacggccacggctctgcacactggatcgtcgga
aactggagcgagtgctccaccacatgtggcctgggggcctactggagaagggtggagtgc
agcacccagatggattctgactgtgcggccatccagagacctgaccctgcaaaaagatgc
cacctccgtccctgtgctggctggaaagtgggaaactggagcaagtgctccagaaactgc
agtgggggcttcaagatacgcgagattcagtgcgtggacagccgggaccaccggaacctg
aggccatttcactgccagttcctggccggcattcctcccccattgagcatgagctgtaac
ccggagccctgtgaggcgtggcaggtggagccttggagccagtgctccaggtcctgtgga
ggtggagttcaggagagaggagtgttctgtccaggaggcctctgtgattggacaaaaaga
cccacatccaccatgtcttgcaatgagcacctgtgctgtcactgggccactgggaactgg
gacctgtgttccacttcctgtggaggtggctttcagaagaggactgtccaatgtgtgccc
tcagagggcaataaaactgaagaccaagaccaatgtctatgtgatcacaaacccagacct
ccagaattcaaaaaatgcaaccagcaggcctgcaagaaaagtgccgatttactttgcact
aaggacaaactgtcagccagtttctgccagacactgaaagccatgaagaaatgttctgtg
cccaccgtgagggctgagtgctgcttctcgtgtccccagacacacatcacacacacccaa
aggcaaagaaggcaacggttgctccaaaagtcaaaagaactctaa

DBGET integrated database retrieval system