KEGG   Homo sapiens (human): 81793Help
Entry
81793             CDS       T01001                                 

Gene name
TLR10, CD290
Definition
(RefSeq) toll like receptor 10
  KO
K10171  toll-like receptor 10
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04054 Pattern recognition receptors [BR:hsa04054]
    81793 (TLR10)
   04090 CD molecules [BR:hsa04090]
    81793 (TLR10)
Pattern recognition receptors [BR:hsa04054]
 Membrane-bound pattern recognition receptors
  Toll-like receptors
   81793 (TLR10)
CD molecules [BR:hsa04090]
 Proteins
  81793 (TLR10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: TIR LRR_8 LRR_4 TIR_2 LRR_1 LRRCT LRR_9
Motif
Other DBs
NCBI-GeneID: 81793
NCBI-ProteinID: NP_001017388
OMIM: 606270
HGNC: 15634
Ensembl: ENSG00000174123
Vega: OTTHUMG00000128578
Pharos: Q9BXR5(Tbio)
UniProt: Q9BXR5 A0A024R9W4
Structure
PDB: 

Position
4p14
AA seq 811 aa AA seqDB search
MRLIRNIYIFCSIVMTAEGDAPELPEERELMTNCSNMSLRKVPADLTPATTTLDLSYNLL
FQLQSSDFHSVSKLRVLILCHNRIQQLDLKTFEFNKELRYLDLSNNRLKSVTWYLLAGLR
YLDLSFNDFDTMPICEEAGNMSHLEILGLSGAKIQKSDFQKIAHLHLNTVFLGFRTLPHY
EEGSLPILNTTKLHIVLPMDTNFWVLLRDGIKTSKILEMTNIDGKSQFVSYEMQRNLSLE
NAKTSVLLLNKVDLLWDDLFLILQFVWHTSVEHFQIRNVTFGGKAYLDHNSFDYSNTVMR
TIKLEHVHFRVFYIQQDKIYLLLTKMDIENLTISNAQMPHMLFPNYPTKFQYLNFANNIL
TDELFKRTIQLPHLKTLILNGNKLETLSLVSCFANNTPLEHLDLSQNLLQHKNDENCSWP
ETVVNMNLSYNKLSDSVFRCLPKSIQILDLNNNQIQTVPKETIHLMALRELNIAFNFLTD
LPGCSHFSRLSVLNIEMNFILSPSLDFVQSCQEVKTLNAGRNPFRCTCELKNFIQLETYS
EVMMVGWSDSYTCEYPLNLRGTRLKDVHLHELSCNTALLIVTIVVIMLVLGLAVAFCCLH
FDLPWYLRMLGQCTQTWHRVRKTTQEQLKRNVRFHAFISYSEHDSLWVKNELIPNLEKED
GSILICLYESYFDPGKSISENIVSFIEKSYKSIFVLSPNFVQNEWCHYEFYFAHHNLFHE
NSDHIILILLEPIPFYCIPTRYHKLKALLEKKAYLEWPKDRRKCGLFWANLRAAINVNVL
ATREMYELQTFTELNEESRGSTISLMRTDCL
NT seq 2436 nt NT seq  +upstreamnt  +downstreamnt
atgagactcatcagaaacatttacatattttgtagtattgttatgacagcagagggtgat
gctccagagctgccagaagaaagggaactgatgaccaactgctccaacatgtctctaaga
aaggttcccgcagacttgaccccagccacaacgacactggatttatcctataacctcctt
tttcaactccagagttcagattttcattctgtctccaaactgagagttttgattctatgc
cataacagaattcaacagctggatctcaaaacctttgaattcaacaaggagttaagatat
ttagatttgtctaataacagactgaagagtgtaacttggtatttactggcaggtctcagg
tatttagatctttcttttaatgactttgacaccatgcctatctgtgaggaagctggcaac
atgtcacacctggaaatcctaggtttgagtggggcaaaaatacaaaaatcagatttccag
aaaattgctcatctgcatctaaatactgtcttcttaggattcagaactcttcctcattat
gaagaaggtagcctgcccatcttaaacacaacaaaactgcacattgttttaccaatggac
acaaatttctgggttcttttgcgtgatggaatcaagacttcaaaaatattagaaatgaca
aatatagatggcaaaagccaatttgtaagttatgaaatgcaacgaaatcttagtttagaa
aatgctaagacatcggttctattgcttaataaagttgatttactctgggacgaccttttc
cttatcttacaatttgtttggcatacatcagtggaacactttcagatccgaaatgtgact
tttggtggtaaggcttatcttgaccacaattcatttgactactcaaatactgtaatgaga
actataaaattggagcatgtacatttcagagtgttttacattcaacaggataaaatctat
ttgcttttgaccaaaatggacatagaaaacctgacaatatcaaatgcacaaatgccacac
atgcttttcccgaattatcctacgaaattccaatatttaaattttgccaataatatctta
acagacgagttgtttaaaagaactatccaactgcctcacttgaaaactctcattttgaat
ggcaataaactggagacactttctttagtaagttgctttgctaacaacacacccttggaa
cacttggatctgagtcaaaatctattacaacataaaaatgatgaaaattgctcatggcca
gaaactgtggtcaatatgaatctgtcatacaataaattgtctgattctgtcttcaggtgc
ttgcccaaaagtattcaaatacttgacctaaataataaccaaatccaaactgtacctaaa
gagactattcatctgatggccttacgagaactaaatattgcatttaattttctaactgat
ctccctggatgcagtcatttcagtagactttcagttctgaacattgaaatgaacttcatt
ctcagcccatctctggattttgttcagagctgccaggaagttaaaactctaaatgcggga
agaaatccattccggtgtacctgtgaattaaaaaatttcattcagcttgaaacatattca
gaggtcatgatggttggatggtcagattcatacacctgtgaataccctttaaacctaagg
ggaactaggttaaaagacgttcatctccacgaattatcttgcaacacagctctgttgatt
gtcaccattgtggttattatgctagttctggggttggctgtggccttctgctgtctccac
tttgatctgccctggtatctcaggatgctaggtcaatgcacacaaacatggcacagggtt
aggaaaacaacccaagaacaactcaagagaaatgtccgattccacgcatttatttcatac
agtgaacatgattctctgtgggtgaagaatgaattgatccccaatctagagaaggaagat
ggttctatcttgatttgcctttatgaaagctactttgaccctggcaaaagcattagtgaa
aatattgtaagcttcattgagaaaagctataagtccatctttgttttgtctcccaacttt
gtccagaatgagtggtgccattatgaattctactttgcccaccacaatctcttccatgaa
aattctgatcatataattcttatcttactggaacccattccattctattgcattcccacc
aggtatcataaactgaaagctctcctggaaaaaaaagcatacttggaatggcccaaggat
aggcgtaaatgtgggcttttctgggcaaaccttcgagctgctattaatgttaatgtatta
gccaccagagaaatgtatgaactgcagacattcacagagttaaatgaagagtctcgaggt
tctacaatctctctgatgagaacagattgtctataa

DBGET integrated database retrieval system