KEGG   Homo sapiens (human): 81797Help
Entry
81797             CDS       T01001                                 

Gene name
OR12D3, hs6M1-27
Definition
(RefSeq) olfactory receptor family 12 subfamily D member 3
  KO
K04257  olfactory receptor
Organism
hsa  Homo sapiens (human)
Pathway
hsa04740  Olfactory transduction
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09150 Organismal Systems
  09157 Sensory system
   04740 Olfactory transduction
    81797 (OR12D3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    81797 (OR12D3)
G protein-coupled receptors [BR:hsa04030]
 Others
  Chemoreception
   Olfactory
    81797 (OR12D3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_4 7tm_1 7TM_GPCR_Srsx
Motif
Other DBs
NCBI-GeneID: 81797
NCBI-ProteinID: NP_112221
HGNC: 13963
Ensembl: ENSG00000112462
Vega: OTTHUMG00000031051
Pharos: Q9UGF7(Tdark)
UniProt: Q9UGF7 D2XT27
Position
6p22.1
AA seq 316 aa AA seqDB search
MENVTTMNEFLLLGLTGVQELQPFFFGIFLIIYLINLIGNGSILVMVVLEPQLHSPMYFF
LGNLSCLDISYSSVTLPKLLVNLVCSRRAISFLGCITQLHFFHFLGSTEAILLAIMAFDR
FVAICNPLRYTVIMNPQVCILLAAAAWLISFFYALMHSVMTAHLSFCGSQKLNHFFYDVK
PLLELACSDTLLNQWLLSIVTGSISMGAFFLTLLSCFYVIGFLLFKNRSCRILHKALSTC
ASHFMVVCLFYGPVGFTYIRPASATSMIQDRIMAIMYSAVTPVLNPLIYTLRNKEVMMAL
KKIFGRKLFKDWQQHH
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atggagaatgtcactacaatgaatgagtttcttctacttggcctgactggtgttcaggag
ctgcagcctttcttctttgggattttcttaatcatttacctgataaacttgattggaaat
ggatctatattggtgatggttgttttggaaccacaactccactcccctatgtattttttt
ctgggaaacctttcttgtctggatatttcttattcttcagtgacactgcccaagctgctc
gtaaacctcgtgtgcagtcgcagggctatatcttttctaggctgtatcacccagctacac
ttcttccactttttgggaagcacagaggccattttactggctatcatggcctttgaccgt
tttgttgccatctgcaatcctcttcgctacactgtcatcatgaacccccaggtgtgtatt
ctgttggcagctgcggcctggctcatcagcttcttttacgctctgatgcattctgtcatg
actgcacacctgagtttttgtggctctcagaaactcaatcacttcttctacgatgtcaag
ccgctcttagaattggcctgtagtgacacattactcaatcaatggcttctttccattgtc
acaggcagcatatccatgggagctttctttctgactcttctctcctgcttctatgtaatt
ggcttccttctgtttaagaacaggtcctgcagaatactccacaaggctctgtccacttgt
gcctcccattttatggtggtatgtcttttctatggacctgtgggcttcacatatattcgt
cctgcttcagccacctccatgattcaggaccggataatggccatcatgtatagcgccgtc
acccctgtactgaatccactaatctacacccttaggaacaaagaagtgatgatggctctg
aagaaaatctttggtaggaagttgtttaaagactggcagcaacaccactag

DBGET integrated database retrieval system