KEGG   Homo sapiens (human): 818Help
Entry
818               CDS       T01001                                 

Gene name
CAMK2G, CAMK, CAMK-II, CAMKG, MRD59
Definition
(RefSeq) calcium/calmodulin dependent protein kinase II gamma
  KO
K04515  calcium/calmodulin-dependent protein kinase (CaM kinase) II [EC:2.7.11.17]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04012  ErbB signaling pathway
hsa04020  Calcium signaling pathway
hsa04024  cAMP signaling pathway
hsa04066  HIF-1 signaling pathway
hsa04114  Oocyte meiosis
hsa04217  Necroptosis
hsa04261  Adrenergic signaling in cardiomyocytes
hsa04310  Wnt signaling pathway
hsa04360  Axon guidance
hsa04713  Circadian entrainment
hsa04720  Long-term potentiation
hsa04722  Neurotrophin signaling pathway
hsa04725  Cholinergic synapse
hsa04728  Dopaminergic synapse
hsa04740  Olfactory transduction
hsa04750  Inflammatory mediator regulation of TRP channels
hsa04911  Insulin secretion
hsa04912  GnRH signaling pathway
hsa04916  Melanogenesis
hsa04921  Oxytocin signaling pathway
hsa04922  Glucagon signaling pathway
hsa04925  Aldosterone synthesis and secretion
hsa04934  Cushing syndrome
hsa04971  Gastric acid secretion
hsa05031  Amphetamine addiction
hsa05152  Tuberculosis
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05214  Glioma
Network
nt06220  Calcium signaling
nt06273  Glioma
nt06316  Angiotensin-aldosterone signaling
  Element
N00026  EGF-EGFR-PLCG-CAMK signaling pathway
N00027  Amplified EGFR to PLCG-CAMK signaling pathway
N00028  PDGF-PDGFR-PLCG-CAMK signaling pathway
N00029  Amplified PDGFR to PLCG-CAMK signaling pathway
N00301  Angiotensin-aldosterone signaling pathway
N00302  Mutation-activated CACNA1D/H to angiotensin-aldosterone signaling pathway
N00303  Mutation-activated KCNJ5 to angiotensin-aldosterone signaling pathway
N00304  Mutation-inactivated ATP1A1 to angiotensin-aldosterone signaling pathway
N00305  Mutation-inactivated ATP2B3 to angiotensin-aldosterone signaling pathway
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    818 (CAMK2G)
   04310 Wnt signaling pathway
    818 (CAMK2G)
   04066 HIF-1 signaling pathway
    818 (CAMK2G)
   04020 Calcium signaling pathway
    818 (CAMK2G)
   04024 cAMP signaling pathway
    818 (CAMK2G)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    818 (CAMK2G)
   04217 Necroptosis
    818 (CAMK2G)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    818 (CAMK2G)
   04922 Glucagon signaling pathway
    818 (CAMK2G)
   04912 GnRH signaling pathway
    818 (CAMK2G)
   04921 Oxytocin signaling pathway
    818 (CAMK2G)
   04916 Melanogenesis
    818 (CAMK2G)
   04925 Aldosterone synthesis and secretion
    818 (CAMK2G)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    818 (CAMK2G)
  09154 Digestive system
   04971 Gastric acid secretion
    818 (CAMK2G)
  09156 Nervous system
   04725 Cholinergic synapse
    818 (CAMK2G)
   04728 Dopaminergic synapse
    818 (CAMK2G)
   04720 Long-term potentiation
    818 (CAMK2G)
   04722 Neurotrophin signaling pathway
    818 (CAMK2G)
  09157 Sensory system
   04740 Olfactory transduction
    818 (CAMK2G)
   04750 Inflammatory mediator regulation of TRP channels
    818 (CAMK2G)
  09158 Development and regeneration
   04360 Axon guidance
    818 (CAMK2G)
  09159 Environmental adaptation
   04713 Circadian entrainment
    818 (CAMK2G)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    818 (CAMK2G)
   05205 Proteoglycans in cancer
    818 (CAMK2G)
  09162 Cancer: specific types
   05214 Glioma
    818 (CAMK2G)
  09165 Substance dependence
   05031 Amphetamine addiction
    818 (CAMK2G)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    818 (CAMK2G)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    818 (CAMK2G)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    818 (CAMK2G)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.17  Ca2+/calmodulin-dependent protein kinase
     818 (CAMK2G)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: CAMK group
  CAMK2 family
   818 (CAMK2G)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CaMKII_AD Pkinase_Tyr SnoaL_3 DUF4440 APH Pkinase_fungal Kdo SnoaL_2 RIO1
Motif
Other DBs
NCBI-GeneID: 818
NCBI-ProteinID: NP_001191421
OMIM: 602123
HGNC: 1463
Ensembl: ENSG00000148660
Vega: OTTHUMG00000018492
Pharos: Q13555(Tchem)
UniProt: Q13555
Structure
PDB: 

Position
10q22.2
AA seq 539 aa AA seqDB search
MATTATCTRFTDDYQLFEELGKGAFSVVRRCVKKTSTQEYAAKIINTKKLSARDHQKLER
EARICRLLKHPNIVRLHDSISEEGFHYLVFDLVTGGELFEDIVAREYYSEADASHCIHQI
LESVNHIHQHDIVHRDLKPENLLLASKCKGAAVKLADFGLAIEVQGEQQAWFGFAGTPGY
LSPEVLRKDPYGKPVDIWACGVILYILLVGYPPFWDEDQHKLYQQIKAGAYDFPSPEWDT
VTPEAKNLINQMLTINPAKRITADQALKHPWVCQRSTVASMMHRQETVECLRKFNARRKL
KGAILTTMLVSRNFSVGRQSSAPASPAASAAGLAGQAAKSLLNKKSDGGVKPQSNNKNSL
VSPAQEPAPLQTAMEPQTTVVHNATDGIKGSTESCNTTTEDEDLKVRKQEIIKITEQLIE
AINNGDFEAYTKICDPGLTSFEPEALGNLVEGMDFHKFYFENLLSKNSKPIHTTILNPHV
HVIGEDAACIAYIRLTQYIDGQGRPRTSQSEETRVWHRRDGKWLNVHYHCSGAPAAPLQ
NT seq 1620 nt NT seq  +upstreamnt  +downstreamnt
atggccaccaccgccacctgcacccgtttcaccgacgactaccagctcttcgaggagctt
ggcaagggtgctttctctgtggtccgcaggtgtgtgaagaaaacctccacgcaggagtac
gcagcaaaaatcatcaataccaagaagttgtctgcccgggatcaccagaaactagaacgt
gaggctcggatatgtcgacttctgaaacatccaaacatcgtgcgcctccatgacagtatt
tctgaagaagggtttcactacctcgtgtttgaccttgttaccggcggggagctgtttgaa
gacattgtggccagagagtactacagtgaagcagatgccagccactgtatacatcagatt
ctggagagtgttaaccacatccaccagcatgacatcgtccacagggacctgaagcctgag
aacctgctgctggcgagtaaatgcaagggtgccgccgtcaagctggctgattttggccta
gccatcgaagtacagggagagcagcaggcttggtttggttttgctggcaccccaggttac
ttgtcccctgaggtcttgaggaaagatccctatggaaaacctgtggatatctgggcctgc
ggggtcatcctgtatatcctcctggtgggctatcctcccttctgggatgaggatcagcac
aagctgtatcagcagatcaaggctggagcctatgatttcccatcaccagaatgggacacg
gtaactcctgaagccaagaacttgatcaaccagatgctgaccataaacccagcaaagcgc
atcacggctgaccaggctctcaagcacccgtgggtctgtcaacgatccacggtggcatcc
atgatgcatcgtcaggagactgtggagtgtttgcgcaagttcaatgcccggagaaaactg
aagggtgccatcctcacgaccatgcttgtctccaggaacttctcagttggcaggcagagc
tccgcccccgcctcgcctgccgcgagcgccgccggcctggccgggcaagctgccaaaagc
ctattgaacaagaagtcggatggcggtgtcaagccacagagcaacaacaaaaacagtctc
gtaagcccagcccaagagcccgcgcccttgcagacggccatggagccacaaaccactgtg
gtacacaacgctacagatgggatcaagggctccacagagagctgcaacaccaccacagaa
gatgaggacctcaaagtgcgaaaacaggagatcattaagattacagaacagctgattgaa
gccatcaacaatggggactttgaggcctacacgaagatttgtgatccaggcctcacttcc
tttgagcctgaggcccttggtaacctcgtggaggggatggatttccataagttttacttt
gagaatctcctgtccaagaacagcaagcctatccataccaccatcctaaacccacacgtc
cacgtgattggggaggacgcagcgtgcatcgcctacatccgcctcacccagtacatcgac
gggcagggtcggcctcgcaccagccagtcagaagagacccgggtctggcaccgtcgggat
ggcaagtggctcaatgtccactatcactgctcaggggcccctgccgcaccgctgcagtga

DBGET integrated database retrieval system