KEGG   Homo sapiens (human): 81848Help
Entry
81848             CDS       T01001                                 

Gene name
SPRY4, HH17
Definition
(RefSeq) sprouty RTK signaling antagonist 4
  KO
K17385  protein sprouty homolog 4
Organism
hsa  Homo sapiens (human)
Disease
H00255  Hypogonadotropic hypogonadism
SSDB OrthologParalogGFIT
Motif
Pfam: Sprouty
Motif
Other DBs
NCBI-GeneID: 81848
NCBI-ProteinID: NP_001120968
OMIM: 607984
HGNC: 15533
Ensembl: ENSG00000187678
Vega: OTTHUMG00000129663
Pharos: Q9C004(Tbio)
UniProt: Q9C004
Position
5q31.3
AA seq 299 aa AA seqDB search
MEPPIPQSAPLTPNSVMVQPLLDSRMSHSRLQHPLTILPIDQVKTSHVENDYIDNPSLAL
TTGPKRTRGGAPELAPTPARCDQDVTHHWISFSGRPSSVSSSSSTSSDQRLLDHMAPPPV
ADQASPRAVRIQPKVVHCQPLDLKGPAVPPELDKHFLLCEACGKCKCKECASPRTLPSCW
VCNQECLCSAQTLVNYGTCMCLVQGIFYHCTNEDDEGSCADHPCSCSRSNCCARWSFMGA
LSVVLPCLLCYLPATGCVKLAQRGYDRLRRPGCRCKHTNSVICKAASGDAKTSRPDKPF
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atggagcccccgatcccacagagcgcccccttgactcccaactcagtcatggtccagccc
cttcttgacagccggatgtcccacagccggctccagcacccactcaccatcctacccatt
gaccaggtgaagaccagccatgtggagaatgactacatagacaaccctagcctggccctg
accaccggcccaaagcggacccggggcggggccccagagctggccccgacgcccgcccgc
tgtgaccaggatgtcacccaccattggatctccttcagcgggcgccccagctctgtgagc
agcagcagcagcacatcctctgaccaacggctcttagaccacatggcaccaccacccgtg
gctgaccaggcctcaccaagggctgtgcgcatccagcccaaggtggtccactgccagccg
ctggacctcaagggcccggcggtcccacccgagctggacaagcacttcttgctgtgcgag
gcctgtgggaagtgtaaatgcaaggagtgtgcatccccccggacgttgccttcctgctgg
gtctgcaaccaggagtgcctgtgctcagcccagactctggtcaactatggcacgtgcatg
tgtttggtgcagggcatcttctaccactgcacgaatgaggacgatgagggctcctgcgct
gaccacccctgctcctgctcccgctccaactgctgcgcccgctggtccttcatgggtgct
ctctccgtggtgctgccctgcctgctctgctacctgcctgccaccggctgcgtgaagctg
gcccagcgtggctacgaccgtctgcgccgccctggttgccgctgcaagcacacgaacagc
gtcatctgcaaagcagccagcggggatgccaagaccagcaggcccgacaagcctttctga

DBGET integrated database retrieval system