KEGG   Homo sapiens (human): 81858
Entry
81858             CDS       T01001                                 

Gene name
SHARPIN, SIPL1
Definition
(RefSeq) SHANK associated RH domain interactor
  KO
K20894  shank-associated RH domain-interacting protein
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa04621  NOD-like receptor signaling pathway
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    81858 (SHARPIN)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    81858 (SHARPIN)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    81858 (SHARPIN)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:hsa04121]
    81858 (SHARPIN)
Ubiquitin system [BR:hsa04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   LUBAC complex
    81858 (SHARPIN)
SSDB
Motif
Pfam: Sharpin_PH zf-RanBP ubiquitin
Other DBs
NCBI-GeneID: 81858
NCBI-ProteinID: NP_112236
OMIM: 611885
HGNC: 25321
Ensembl: ENSG00000179526
Vega: OTTHUMG00000165243
Pharos: Q9H0F6(Tbio)
UniProt: Q9H0F6 Q6PJD5
Structure
PDB: 
4EMO 5X0W

Position
8q24.3
AA seq 387 aa
MAPPAGGAAAAASDLGSAAVLLAVHAAVRPLGAGPDAEAQLRRLQLSADPERPGRFRLEL
LGAGPGAVNLEWPLESVSYTIRGPTQHELQPPPGGPGTLSLHFLNPQEAQRWAVLVRGAT
VEGQNGSKSNSPPALGPEACPVSLPSPPEASTLKGPPPEADLPRSPGNLTEREELAGSLA
RAIAGGDEKGAAQVAAVLAQHRVALSVQLQEACFPPGPIRLQVTLEDAASAASAASSAHV
ALQVHPHCTVAALQEQVFSELGFPPAVQRWVIGRCLCVPERSLASYGVRQDGDPAFLYLL
SAPREAPATGPSPQHPQKMDGELGRLFPPSLGLPPGPQPAASSLPSPLQPSWSCPSCTFI
NAPDRPGCEMCSTQRPCTWDPLAAAST
NT seq 1164 nt   +upstreamnt  +downstreamnt
atggcgccgccagcgggcggggcggcggcggcggcctcggacttgggctccgccgcagtg
ctcttggctgtgcacgccgcggtgaggccgctgggcgccgggccagacgccgaggcacag
ctgcggaggctgcagctgagcgcggaccctgagcggcctgggcgcttccggctggagctg
ctgggcgcgggacctggggcggttaatttggagtggcccctggagtcagtttcctacacc
atccgaggccccacccagcacgagctacagcctccaccaggagggcctggaaccctcagc
ctgcacttcctcaaccctcaggaagctcagcggtgggcagtcctagtccgaggtgccacc
gtggaaggacagaatggcagcaagagcaactcaccaccagccttgggcccagaagcatgc
cctgtctccctgcccagtcccccggaagcctccacactcaagggccctccacctgaggca
gatcttcctaggagccctggaaacttgacggagagagaagagctggcagggagcctggcc
cgggctattgcaggtggagacgagaagggggcagcccaagtggcagccgtcctggcccag
catcgtgtggccctgagtgttcagcttcaggaggcctgcttcccacctggccccatcagg
ctgcaggtcacacttgaagacgctgcctctgccgcatccgccgcgtcctctgcacacgtt
gccctgcaggtccacccccactgcactgttgcagctctccaggagcaggtgttctcagag
ctcggtttcccgccagccgtgcaacgctgggtcatcggacggtgcctgtgtgtgcctgag
cgcagccttgcctcttacggggttcggcaggatggggaccctgctttcctctacttgctg
tcagctcctcgagaagccccagccacaggacctagccctcagcacccccagaagatggac
ggggaacttggacgcttgtttcccccatcattggggctacccccaggcccccagccagct
gcctccagcctgcccagtccactccagcccagctggtcctgtccttcctgcaccttcatc
aatgccccagaccgccctggctgtgagatgtgtagcacccagaggccctgcacttgggac
ccccttgctgcagcttccacctag

DBGET integrated database retrieval system