KEGG   Homo sapiens (human): 81872
Entry
81872             CDS       T01001                                 

Gene name
KRTAP2-1, KAP2.1A, KRTAP2.1A
Definition
(RefSeq) keratin associated protein 2-1
Organism
hsa  Homo sapiens (human)
SSDB
Motif
Pfam: Keratin_B2 Keratin_B2_2
Other DBs
NCBI-GeneID: 81872
NCBI-ProteinID: NP_001116859
HGNC: 16775
Ensembl: ENSG00000212725
Vega: OTTHUMG00000171405
Pharos: Q9BYU5(Tdark)
UniProt: Q9BYU5
Position
17q21.2
AA seq 128 aa
MTGSCCGSTFSSLSYGGGCCQPCCCRDPCCCRPVTCQTTVCRPVTCVPRCTRPICEPCRR
PVCCDPCSLQEGCCRPITCCPSSCTAVVCRPCCWATTCCQPVSVQSPCCRPPCGQPTPCS
TTCRTSSC
NT seq 387 nt   +upstreamnt  +downstreamnt
atgaccggctcctgctgcggctccaccttctcctccctgagctacgggggaggctgctgc
cagccctgctgctgccgcgacccctgctgctgccgccccgtgacctgccagaccaccgtg
tgccgccccgtgacctgcgtgccccgctgcacgcgccccatctgcgagccctgccgccgc
ccggtgtgctgcgacccctgctccctgcaggaaggctgctgccgccccatcacctgctgc
ccctcgtcgtgcacggctgtggtgtgcaggccctgctgctgggccaccacctgctgccag
cctgtgtctgtgcagtccccctgctgccggcccccctgcggccagccgaccccttgcagc
accacctgcaggacctcctcctgctga

DBGET integrated database retrieval system