KEGG   Homo sapiens (human): 81876Help
Entry
81876             CDS       T01001                                 

Gene name
RAB1B
Definition
(RefSeq) RAB1B, member RAS oncogene family
  KO
K07875  Ras-related protein Rab-1B
Organism
hsa  Homo sapiens (human)
Pathway
hsa05134  Legionellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05134 Legionellosis
    81876 (RAB1B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    81876 (RAB1B)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    81876 (RAB1B)
   04031 GTP-binding proteins [BR:hsa04031]
    81876 (RAB1B)
Membrane trafficking [BR:hsa04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Rab GTPases
    81876 (RAB1B)
 Autophagy
  Other autophagy associated proteins
    81876 (RAB1B)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   81876 (RAB1B)
  Exosomal proteins of other body fluids (saliva and urine)
   81876 (RAB1B)
  Exosomal proteins of colorectal cancer cells
   81876 (RAB1B)
  Exosomal proteins of bladder cancer cells
   81876 (RAB1B)
GTP-binding proteins [BR:hsa04031]
 Small (monomeric) G-proteins
  Rab Family
   Rab1/35 [OT]
    81876 (RAB1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf RsgA_GTPase MMR_HSR1 SRPRB Gtr1_RagA GTP_EFTU AAA FeoB_N ABC_tran AAA_16 AAA_7 AAA_22 Septin PduV-EutP AAA_29 AAA_5 TniB
Motif
Other DBs
NCBI-GeneID: 81876
NCBI-ProteinID: NP_112243
OMIM: 612565
HGNC: 18370
Ensembl: ENSG00000174903
Vega: OTTHUMG00000166916
Pharos: Q9H0U4(Tbio)
UniProt: Q9H0U4
Structure
PDB: 

Position
11q13.2
AA seq 201 aa AA seqDB search
MNPEYDYLFKLLLIGDSGVGKSCLLLRFADDTYTESYISTIGVDFKIRTIELDGKTIKLQ
IWDTAGQERFRTITSSYYRGAHGIIVVYDVTDQESYANVKQWLQEIDRYASENVNKLLVG
NKSDLTTKKVVDNTTAKEFADSLGIPFLETSAKNATNVEQAFMTMAAEIKKRMGPGAASG
GERPNLKIDSTPVKPAGGGCC
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaaccccgaatatgactacctgtttaagctgcttttgattggcgactcaggcgtgggc
aagtcatgcctgctcctgcggtttgctgatgacacgtacacagagagctacatcagcacc
atcggggtggacttcaagatccgaaccatcgagctggatggcaaaactatcaaacttcag
atctgggacacagcgggccaggaacggttccggaccatcacttccagctactaccggggg
gctcatggcatcatcgtggtgtatgacgtcactgaccaggaatcctacgccaacgtgaag
cagtggctgcaggagattgaccgctatgccagcgagaacgtcaataagctcctggtgggc
aacaagagcgacctcaccaccaagaaggtggtggacaacaccacagccaaggagtttgca
gactctctgggcatccccttcttggagacgagcgccaagaatgccaccaatgtcgagcag
gcgttcatgaccatggctgctgaaatcaaaaagcggatggggcctggagcagcctctggg
ggcgagcggcccaatctcaagatcgacagcacccctgtaaagccggctggcggtggctgt
tgctag

DBGET integrated database retrieval system