KEGG   Homo sapiens (human): 81889
Entry
81889             CDS       T01001                                 

Symbol
FAHD1, C16orf36, YISKL
Name
(RefSeq) fumarylacetoacetate hydrolase domain containing 1
  KO
K01557  acylpyruvate hydrolase [EC:3.7.1.5]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00350  Tyrosine metabolism
hsa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    81889 (FAHD1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.5  acylpyruvate hydrolase
     81889 (FAHD1)
SSDB
Motif
Pfam: FAA_hydrolase
Other DBs
NCBI-GeneID: 81889
NCBI-ProteinID: NP_001135870
OMIM: 616320
HGNC: 14169
Ensembl: ENSG00000180185
Vega: OTTHUMG00000128663
Pharos: Q6P587(Tbio)
UniProt: Q6P587
Structure
PDB: 
6FOH 6FOG 1SAW

Position
16p13.3
AA seq 223 aa
MAASRPLSRFWEWGKNIVCVGRNYADHVREMRSAVLSEPVLFLKPSTAYAPEGSPILMPA
YTRNLHHELELGVVMGKRCRAVPEAAAMDYVGGYALCLDMTARDVQDECKKKGLPWTLAK
SFTASCPVSAFVPKEKIPDPHKLKLWLKVNGELRQEGETSSMIFSIPYIISYVSKIITLE
EGDIILTGTPKGVGPVKENDEIEAGIHGLPKVSSATLPVRLQE
NT seq 672 nt   +upstreamnt  +downstreamnt
atggcagcatccaggccattgtcccgcttctgggagtggggaaagaacatcgtctgcgtg
gggaggaactacgcggaccacgtcagggagatgcgcagcgcggtgttgagcgagcccgtg
ctgttcctgaagccgtccacggcctacgcgcccgagggctcgcccatcctcatgcccgcg
tacactcgcaacctgcaccacgagctggagctgggcgtggtgatgggcaagcgctgccgc
gcagtccccgaggctgcggccatggactacgtgggcggctatgccctgtgcctggatatg
accgcccgggacgtgcaggacgagtgcaagaagaaggggctgccctggactctggcgaag
agcttcacggcgtcctgcccggtcagcgcgttcgtgcccaaggagaagatccctgaccct
cacaagctgaagctctggctcaaggtcaacggcgaactcagacaggagggtgagacatcc
tccatgattttttccatcccctacatcatcagctatgtttctaagatcataaccttggaa
gaaggagatattatcttgactgggacgccaaagggagttggaccggttaaagaaaacgat
gagatcgaggctggcatacacgggctgcccaaagtctcctcagcaacacttcctgtgaga
ctacaggaatga

DBGET integrated database retrieval system