KEGG   Homo sapiens (human): 81892
Entry
81892             CDS       T01001                                 
Symbol
SLIRP, C14orf156, DC50, PD04872
Name
(RefSeq) SRA stem-loop interacting RNA binding protein
  KO
K25095  SRA stem-loop-interacting RNA-binding protein, mitochondrial
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   03037 Cilium and associated proteins [BR:hsa03037]
    81892 (SLIRP)
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    81892 (SLIRP)
Cilium and associated proteins [BR:hsa03037]
 Motile cilia and associated proteins
  Sperm flagellum proteins
   81892 (SLIRP)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 Other domain-containing proteins
  RRM domain-containing proteins
   81892 (SLIRP)
SSDB
Motif
Pfam: RRM_1 Nup35_RRM
Other DBs
NCBI-GeneID: 81892
NCBI-ProteinID: NP_112487
OMIM: 610211
HGNC: 20495
Ensembl: ENSG00000119705
Pharos: Q9GZT3(Tbio)
UniProt: Q9GZT3
Position
14:77708071..77717598
AA seq 109 aa
MAASAARGAAALRRSINQPVAFVRRIPWTAASSQLKEHFAQFGHVRRCILPFDKETGFHR
GLGWVQFSSEEGLRNALQQENHIIDGVKVQVHTRRPKLPQTSDDEKKDF
NT seq 330 nt   +upstreamnt  +downstreamnt
atggcggcctcagcagcgagaggtgctgcggcgctgcgtagaagtatcaatcagccggtt
gcttttgtgagaagaattccttggactgcggcgtcgagtcagctgaaagaacactttgca
cagttcggccatgtcagaaggtgcattttaccttttgacaaggagactggctttcacaga
ggtttgggttgggttcagttttcttcagaagaaggacttcggaatgcactacaacaggaa
aatcatattatagatggagtaaaggtccaggttcacactagaaggccaaaacttccgcaa
acatctgatgatgaaaagaaagatttttga

DBGET integrated database retrieval system