KEGG   Homo sapiens (human): 81894
Entry
81894             CDS       T01001                                 

Gene name
SLC25A28, MFRN2, MRS3/4, MRS4L, NPD016
Definition
(RefSeq) solute carrier family 25 member 28
  KO
K15113  solute carrier family 25 (mitochondrial iron transporter), member 28/37
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    81894 (SLC25A28)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    81894 (SLC25A28)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    81894 (SLC25A28)
Transporters [BR:hsa02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   81894 (SLC25A28)
SSDB
Motif
Pfam: Mito_carr SAT
Other DBs
NCBI-GeneID: 81894
NCBI-ProteinID: NP_112489
OMIM: 609767
HGNC: 23472
Ensembl: ENSG00000155287
Vega: OTTHUMG00000018886
Pharos: Q96A46(Tbio)
UniProt: Q96A46
Position
10q24.2
AA seq 364 aa
MELEGRGAGGVAGGPAAGPGRSPGESALLDGWLQRGVGRGAGGGEAGACRPPVRQDPDSG
PDYEALPAGATVTTHMVAGAVAGILEHCVMYPIDCVKTRMQSLQPDPAARYRNVLEALWR
IIRTEGLWRPMRGLNVTATGAGPAHALYFACYEKLKKTLSDVIHPGGNSHIANGAAGCVA
TLLHDAAMNPAEVVKQRMQMYNSPYHRVTDCVRAVWQNEGAGAFYRSYTTQLTMNVPFQA
IHFMTYEFLQEHFNPQRRYNPSSHVLSGACAGAVAAAATTPLDVCKTLLNTQESLALNSH
ITGHITGMASAFRTVYQVGGVTAYFRGVQARVIYQIPSTAIAWSVYEFFKYLITKRQEEW
RAGK
NT seq 1095 nt   +upstreamnt  +downstreamnt
atggagttggaggggcggggtgctggcggtgtggcgggggggccggcggcagggcccggg
cggagccccggggagtcggcgctgctggacgggtggctgcagcggggcgtgggccggggg
gccggcggcggggaggccggggcctgcaggcccccggtacgacaagatccggactccggc
ccggactacgaggcgctgccggctggagccactgtcaccacgcacatggtggcaggcgcc
gtggcagggatcctggagcactgcgtgatgtaccccatcgactgcgtcaagacccggatg
cagagtctacagcctgacccagctgcccgctatcgcaatgtgttggaggccctctggagg
attataagaacggagggcctatggaggcccatgagggggctgaacgtcacagcaacaggc
gcagggcctgcccacgccctttattttgcctgctacgaaaagttaaaaaagacattgagt
gatgtaatccaccctgggggcaatagccatattgccaatggtgcggccgggtgtgtggca
acattacttcatgatgcagccatgaaccctgcggaagtggtcaagcagaggatgcagatg
tacaactcaccataccaccgggtgacagactgtgtacgggcagtgtggcaaaatgaaggg
gccggggccttttaccgcagctacaccacccagctgaccatgaacgttcctttccaagcc
attcacttcatgacctatgaattcctgcaggagcactttaacccccagagacggtacaac
ccaagctcccacgtcctctctggagcttgcgcaggagctgtagctgccgcagccacaacc
ccactggacgtttgcaaaacactgctcaacacccaggagtccttggctttgaactcacac
attacaggacatatcacaggcatggctagtgccttcaggacggtatatcaagtaggtggg
gtgaccgcctatttccgaggggtgcaggccagagtaatttaccagatcccctccacagcc
atcgcatggtctgtgtatgagttcttcaaatacctaatcactaaaaggcaagaagagtgg
agggctggcaagtga

DBGET integrated database retrieval system