KEGG   Homo sapiens (human): 8192Help
Entry
8192              CDS       T01001                                 

Gene name
CLPP, DFNB81, PRLTS3
Definition
(RefSeq) caseinolytic mitochondrial matrix peptidase proteolytic subunit
  KO
K01358  ATP-dependent Clp protease, protease subunit [EC:3.4.21.92]
Organism
hsa  Homo sapiens (human)
Disease
H02095  Perrault syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    8192 (CLPP)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.92  endopeptidase Clp
     8192 (CLPP)
Peptidases and inhibitors [BR:hsa01002]
 Serine peptidases
  Family S14: ClpP endopeptidase family
   8192 (CLPP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CLP_protease
Motif
Other DBs
NCBI-GeneID: 8192
NCBI-ProteinID: NP_006003
OMIM: 601119
HGNC: 2084
Ensembl: ENSG00000125656
Vega: OTTHUMG00000180779
Pharos: Q16740(Tbio)
UniProt: Q16740
Structure
PDB: 

Position
19p13.3
AA seq 277 aa AA seqDB search
MWPGILVGGARVASCRYPALGPRLAAHFPAQRPPQRTLQNGLALQRCLHATATRALPLIP
IVVEQTGRGERAYDIYSRLLRERIVCVMGPIDDSVASLVIAQLLFLQSESNKKPIHMYIN
SPGGVVTAGLAIYDTMQYILNPICTWCVGQAASMGSLLLAAGTPGMRHSLPNSRIMIHQP
SGGARGQATDIAIQAEEIMKLKKQLYNIYAKHTKQSLQVIESAMERDRYMSPMEAQEFGI
LDKVLVHPPQDGEDEPTLVQKEPVEAAPAAEPVPAST
NT seq 834 nt NT seq  +upstreamnt  +downstreamnt
atgtggcccggaatattggtagggggggcccgggtggcgtcatgcaggtaccccgcgctg
gggcctcgcctcgccgctcactttccagcgcagcggccgccgcagcggacactccagaac
ggcctggccctgcagcggtgcctgcacgcgacggcgacccgggctctcccgctcattccc
atcgtggtggagcagacgggtcgcggcgagcgcgcctatgacatctactcgcggctgctg
cgggagcgcatcgtgtgcgtcatgggcccgatcgatgacagcgttgccagccttgttatc
gcacagctcctcttcctgcaatccgagagcaacaagaagcccatccacatgtacatcaac
agccctggtggtgtggtgaccgcgggcctggccatctacgacacgatgcagtacatcctc
aacccgatctgcacctggtgcgtgggccaggccgccagcatgggctccctgcttctcgcc
gccggcaccccaggcatgcgccactcgctccccaactcccgtatcatgatccaccagccc
tcaggaggcgcccggggccaagccacagacattgccatccaggcagaggagatcatgaag
ctcaagaagcagctctataacatctacgccaagcacaccaaacagagcctgcaggtgatc
gagtccgccatggagagggaccgctacatgagccccatggaggcccaggagtttggcatc
ttagacaaggttctggtccaccctccccaggacggtgaggatgagcccacgctggtgcag
aaggagcctgtagaagcagcgccggcagcagaacctgtcccagctagcacctga

DBGET integrated database retrieval system