KEGG   Homo sapiens (human): 81929Help
Entry
81929             CDS       T01001                                 

Gene name
SEH1L, SEC13L, SEH1A, SEH1B, Seh1
Definition
(RefSeq) SEH1 like nucleoporin
  KO
K14299  nucleoporin SEH1
Organism
hsa  Homo sapiens (human)
Pathway
hsa03013  RNA transport
hsa04150  mTOR signaling pathway
Module
hsa_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:hsa00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    81929 (SEH1L)
 Environmental Information Processing
  Signal transduction
   04150 mTOR signaling pathway
    81929 (SEH1L)
Messenger RNA biogenesis [BR:hsa03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     81929 (SEH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Ge1_WD40
Motif
Other DBs
NCBI-GeneID: 81929
NCBI-ProteinID: NP_112493
OMIM: 609263
HGNC: 30379
Ensembl: ENSG00000085415
Vega: OTTHUMG00000181909
Pharos: Q96EE3(Tbio)
UniProt: Q96EE3
Structure
PDB: 

Position
18p11.21
AA seq 360 aa AA seqDB search
MFVARSIAADHKDLIHDVSFDFHGRRMATCSSDQSVKVWDKSESGDWHCTASWKTHSGSV
WRVTWAHPEFGQVLASCSFDRTAAVWEEIVGESNDKLRGQSHWVKRTTLVDSRTSVTDVK
FAPKHMGLMLATCSADGIVRIYEAPDVMNLSQWSLQHEISCKLSCSCISWNPSSSRAHSP
MIAVGSDDSSPNAMAKVQIFEYNENTRKYAKAETLMTVTDPVHDIAFAPNLGRSFHILAI
ATKDVRIFTLKPVRKELTSSGGPTKFEIHIVAQFDNHNSQVWRVSWNITGTVLASSGDDG
CVRLWKANYMDNWKCTGILKGNGSPVNGSSQQGTSNPSLGSTIPSLQNSLNGSSAGRKHS
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtggctcgcagcatcgcggcggaccacaaggatctcatccacgatgtctctttc
gacttccacgggcggcggatggcaacctgctccagcgatcagagcgttaaggtctgggat
aaaagtgaaagtggtgattggcattgtactgctagctggaagacacatagtggatctgta
tggcgtgtgacatgggcccatcctgaatttgggcaggttttggcttcctgttcttttgac
cgaacagctgctgtatgggaagaaatagtaggagaatcaaatgataaactgcgaggacag
agccactgggttaaaaggacaactctggtggatagcagaacatctgttactgatgtgaag
tttgctcccaagcacatgggtcttatgttagcaacctgttccgcagatggtatagtaaga
atctatgaggcaccagatgttatgaatctcagccagtggtctttgcagcatgagatctca
tgtaagctaagctgtagttgtatttcttggaacccttcaagctctcgtgctcattccccc
atgatcgccgtaggaagtgatgacagtagccccaacgcaatggccaaggttcagattttt
gaatataatgaaaacaccaggaaatatgcaaaagctgaaactcttatgacagtcactgat
cctgttcatgatattgcattcgctccaaatttgggaagatctttccatattctagcaata
gcgaccaaagatgtgagaatttttacattaaagcctgtgaggaaagaactgacttcctct
ggtgggccaacaaagtttgaaatccatatagtggctcagttcgataatcataattctcag
gtctggcgagtgagttggaatataacaggaacggtgctagcatcttcaggagatgatggg
tgtgtaagattgtggaaagctaattatatggacaattggaagtgtactggtattttgaaa
ggtaatgggagcccagtcaatgggagttctcagcagggaacctcaaatccttccctaggt
tcaactattccaagtcttcagaattcattaaatggatcttctgctggcagaaagcacagc
tga

DBGET integrated database retrieval system