KEGG   Homo sapiens (human): 8204Help
Entry
8204              CDS       T01001                                 

Gene name
NRIP1, RIP140
Definition
(RefSeq) nuclear receptor interacting protein 1
  KO
K17965  nuclear receptor-interacting protein 1
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:hsa03029]
    8204 (NRIP1)
Mitochondrial biogenesis [BR:hsa03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    8204 (NRIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NRIP1_repr_4 NRIP1_repr_1 NRIP1_repr_2 NRIP1_repr_3 Methyltrans_RNA
Motif
Other DBs
NCBI-GeneID: 8204
NCBI-ProteinID: NP_003480
OMIM: 602490
HGNC: 8001
Ensembl: ENSG00000180530
Vega: OTTHUMG00000074323
Pharos: P48552(Tbio)
UniProt: P48552 A8K171
Structure
PDB: 

Position
21q11.2-q21.1
AA seq 1158 aa AA seqDB search
MTHGEELGSDVHQDSIVLTYLEGLLMHQAAGGSGTAVDKKSAGHNEEDQNFNISGSAFPT
CQSNGPVLNTHTYQGSGMLHLKKARLLQSSEDWNAAKRKRLSDSIMNLNVKKEALLAGMV
DSVPKGKQDSTLLASLLQSFSSRLQTVALSQQIRQSLKEQGYALSHDSLKVEKDLRCYGV
ASSHLKTLLKKSKVKDQKPDTNLPDVTKNLIRDRFAESPHHVGQSGTKVMSEPLSCAARL
QAVASMVEKRASPATSPKPSVACSQLALLLSSEAHLQQYSREHALKTQNANQAASERLAA
MARLQENGQKDVGSYQLPKGMSSHLNGQARTSSSKLMASKSSATVFQNPMGIIPSSPKNA
GYKNSLERNNIKQAANNSLLLHLLKSQTIPKPMNGHSHSERGSIFEESSTPTTIDEYSDN
NPSFTDDSSGDESSYSNCVPIDLSCKHRTEKSESDQPVSLDNFTQSLLNTWDPKVPDVDI
KEDQDTSKNSKLNSHQKVTLLQLLLGHKNEENVEKNTSPQGVHNDVSKFNTQNYARTSVI
ESPSTNRTTPVSTPPLLTSSKAGSPINLSQHSLVIKWNSPPYVCSTQSEKLTNTASNHSM
DLTKSKDPPGEKPAQNEGAQNSATFSASKLLQNLAQCGMQSSMSVEEQRPSKQLLTGNTD
KPIGMIDRLNSPLLSNKTNAVEENKAFSSQPTGPEPGLSGSEIENLLERRTVLQLLLGNP
NKGKSEKKEKTPLRDESTQEHSERALSEQILMVKIKSEPCDDLQIPNTNVHLSHDAKSAP
FLGMAPAVQRSAPALPVSEDFKSEPVSPQDFSFSKNGLLSRLLRQNQDSYLADDSDRSHR
NNEMALLESKNLCMVPKKRKLYTEPLENPFKKMKNNIVDAANNHSAPEVLYGSLLNQEEL
KFSRNDLEFKYPAGHGSASESEHRSWARESKSFNVLKQLLLSENCVRDLSPHRSNSVADS
KKKGHKNNVTNSKPEFSISSLNGLMYSSTQPSSCMDNRTFSYPGVVKTPVSPTFPEHLGC
AGSRPESGLLNGCSMPSEKGPIKWVITDAEKNEYEKDSPRLTKTNPILYYMLQKGGNSVT
SRETQDKDIWREASSAESVSQVTAKEELLPTAETKASFFNLRSPYNSHMGNNASRPHSAN
GEVYGLLGSVLTIKKESE
NT seq 3477 nt NT seq  +upstreamnt  +downstreamnt
atgactcatggagaagagcttggctctgatgtgcaccaggattctattgttttaacttac
ctagaaggattactaatgcatcaggcagcagggggatcaggtactgccgttgacaaaaag
tctgctgggcataatgaagaggatcagaactttaacatttctggcagtgcatttcccacc
tgtcaaagtaatggtccagttctcaatacacatacatatcaggggtctggcatgctgcac
ctcaaaaaagccagactgttgcagtcttctgaggactggaatgcagcaaagcggaagagg
ctgtctgattctatcatgaatttaaacgtaaagaaggaagctttgctagctggcatggtt
gacagtgtgcctaaaggcaaacaggatagcacattactggcctctttgcttcagtcattc
agctctaggctgcagactgttgctctgtcacaacaaatcaggcagagcctcaaggagcaa
ggatatgccctcagtcatgattctttaaaagtggagaaggatttaaggtgctatggtgtt
gcatcaagtcacttaaaaactttgttgaagaaaagtaaagttaaagatcaaaagcctgat
acgaatcttcctgatgtgactaaaaacctcatcagagataggtttgcagagtctcctcat
catgttggacaaagtggaacaaaggtcatgagtgaaccgttgtcatgtgctgcaagatta
caggctgttgcaagcatggtggaaaaaagggctagtcctgccacctcacctaaacctagt
gttgcttgtagccagttagcattacttctgtcaagcgaagcccatttgcagcagtattct
cgagaacacgctttaaaaacgcaaaatgcaaatcaagcagcaagtgaaagacttgctgct
atggccagattgcaagaaaatggccagaaggatgttggcagttaccagctcccaaaagga
atgtcaagccatcttaatggtcaggcaagaacatcatcaagcaaactgatggctagcaaa
agtagtgctacagtgtttcaaaatccaatgggtatcattccttcttcccctaaaaatgca
ggttataagaactcactggaaagaaacaatataaaacaagctgctaacaatagtttgctt
ttacatcttcttaaaagccagactatacctaagccaatgaatggacacagtcacagtgag
agaggaagcatttttgaggaaagtagtacacctacaactattgatgaatattcagataac
aatcctagttttacagatgacagcagtggtgatgaaagttcttattccaactgtgttccc
atagacttgtcttgcaaacaccgaactgaaaaatcagaatctgaccaacctgtttccctg
gataacttcactcaatccttgctaaacacttgggatccaaaagtcccagatgtagatatc
aaagaagatcaagatacctcaaagaattctaagctaaactcacaccagaaagtaacactt
cttcaattgctacttggccataagaatgaagaaaatgtagaaaaaaacaccagccctcag
ggagtacacaatgatgtgagcaagttcaatacacaaaattatgcaaggacttctgtgata
gaaagccccagtacaaatcggactactccagtgagcactccacctttacttacatcaagc
aaagcagggtctcccatcaatctctctcaacactctctggtcatcaaatggaattcccca
ccatatgtctgcagtactcagtctgaaaagctaacaaatactgcatctaaccactcaatg
gaccttacaaaaagcaaagacccaccaggagagaaaccagcccaaaatgaaggtgcacag
aactctgcaacgtttagtgccagtaagctgttacaaaatttagcacaatgtggaatgcag
tcatccatgtcagtggaagagcagagacccagcaaacagctgttaactggaaacacagat
aaaccgataggtatgattgatagattaaatagccctttgctctcaaataaaacaaatgca
gttgaagaaaataaagcatttagtagtcaaccaacaggtcctgaaccagggctttctggt
tctgaaatagaaaatctgcttgaaagacgtactgtcctccagttgctcctggggaacccc
aacaaagggaagagtgaaaaaaaagagaaaactcccttaagagatgaaagtactcaggaa
cactcagagagagctttaagtgaacaaatactgatggtgaaaataaaatctgagccttgt
gatgacttacaaattcctaacacaaatgtgcacttgagccatgatgctaagagtgcccca
ttcttgggtatggctcctgctgtgcagagaagcgcacctgccttaccagtgtccgaagac
tttaaatcggagcctgtttcacctcaggatttttctttctccaagaatggtctgctaagt
cgattgctaagacaaaatcaagatagttacctggcagatgattcagacaggagtcacaga
aataatgaaatggcacttctagaatcaaagaatctttgcatggtccctaagaaaaggaag
ctttatactgagccattagaaaatccatttaaaaagatgaaaaacaacattgttgatgct
gcaaacaatcacagtgccccagaagtactgtatgggtccttgcttaaccaggaagagctg
aaatttagcagaaatgatcttgaatttaaatatcctgctggtcatggctcagccagcgaa
agtgaacacaggagttgggccagagagagcaaaagctttaatgttctgaaacagctgctt
ctctcagaaaactgtgtgcgagatttgtccccgcacagaagtaactctgtggctgacagt
aaaaagaaaggacacaaaaataatgtgaccaacagcaaacctgaatttagcatttcttct
ttaaatggactgatgtacagttccactcagcccagcagttgcatggataacaggacattt
tcatacccaggtgtagtaaaaactcctgtgagtcctactttccctgagcacttgggctgt
gcagggtctagaccagaatctgggcttttgaatgggtgttccatgcccagtgagaaagga
cccattaagtgggttatcactgatgcggagaagaatgagtatgaaaaagactctccaaga
ttgaccaaaaccaacccaatactatattacatgcttcaaaaaggaggcaattctgttacc
agtcgagaaacacaagacaaggacatttggagggaggcttcatctgctgaaagtgtctca
caggtcacagccaaagaagagttacttcctactgcagaaacgaaagcttctttctttaat
ttaagaagcccttacaatagccatatgggaaataatgcttctcgcccacacagcgcaaat
ggagaagtttatggacttctgggaagcgtgctaacgataaagaaagaatcagaataa

DBGET integrated database retrieval system