KEGG   Homo sapiens (human): 8218Help
Entry
8218              CDS       T01001                                 

Gene name
CLTCL1, CHC22, CLH22, CLTCL, CLTD
Definition
(RefSeq) clathrin heavy chain like 1
  KO
K04646  clathrin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8218 (CLTCL1)
   04142 Lysosome
    8218 (CLTCL1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    8218 (CLTCL1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    8218 (CLTCL1)
 09160 Human Diseases
  09164 Neurodegenerative diseases
   05016 Huntington disease
    8218 (CLTCL1)
  09171 Infectious diseases: Bacterial
   05100 Bacterial invasion of epithelial cells
    8218 (CLTCL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8218 (CLTCL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8218 (CLTCL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    8218 (CLTCL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   8218 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD
Motif
Other DBs
NCBI-GeneID: 8218
NCBI-ProteinID: NP_009029
OMIM: 601273
HGNC: 2093
Ensembl: ENSG00000070371
Vega: OTTHUMG00000150109
Pharos: P53675(Tbio)
UniProt: P53675
Position
22q11.21
AA seq 1640 aa AA seqDB search
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
MDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLE
KHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLR
KQEEHVTEPAPLVFDFDGHE
NT seq 4923 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccctgttcgctttcaggagcacttccagctccaaaaccttggaatt
aatccagctaacattggattcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagttggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccagcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcatactatggcagaagaagtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagaccgcggtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgatagacataccagtctggtgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctgctcgtaggcatctcggctcagcaaaaccgtgtggttggagca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgctgcggct
tttgcagagttcaagatggaggggaatgccaagcctgccacccttttctgctttgctgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaagaaagcagtagatgtgttttttcctccagaggcacagaatgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtacgacctagagtctggcgtgtgcatctgcatgaaccgtattagtgct
gacacaatatttgtcactgctccacacaaaccaacctctggaattattggtgtcaacaaa
aagggacaggtactgtcagtttgtgttgaggaagataacattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccgttcgtagtaacctggctggggca
gagaagttgtttgtgagaaaattcaataccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcgtctgcaccaaagggaatcctgcgtaccagagagacggtccagaaa
ttccagagtatacccgctcagtctggccaggcttctccattgctgcagtacttcggaatc
ctgctcgaccagggtcagctcaataaacttgaatccttagaactttgccatctggttctt
cagcaggggcgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaatgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgaggggt
gtaatgaagatcagtccggaacagggcctgcagttttctcgaatgctagtgcaggacgag
gagccgctggccaacattagccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccagctgagggactcctg
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataaaatgtttactcattacgaccgggcccacattgcccagctctgtgagaaggca
ggcctcctgcagcaagcactggagcactacaccgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttctttggctccttatcggtg
gaggattctgtggagtgtctgcatgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccacgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttacaaaggcctcttctacttcctgggctcaatcgtgaac
ttcagccaagacccagatgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgtgatcgt
tttggctttgtccatgaccttgtcctatatttataccgcaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtgattggagggctgctt
gatgtggattgttctgaggaagtgattaaacacttaatcatggcagtgagaggacagttc
tctactgatgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccagattcaggaaggctgtgaggagcctgccactcacaatgcactggct
aaaatctacatcgacagcaacaacagccccgagtgcttcctgagagagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaagcgagacccccatctggcctgtgttgcc
tatgagcgggggcagtgtgaccttgagctcatcaaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtatgcagaaaggatccggagctctgggctcacgtcctt
gaggagaccaacccatccaggagacagctaattgaccaggtggtacagacagcattgtca
gaaacacgggatcctgaagagatttcggtcactgtcaaagcctttatgacagccgacctg
cctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcagcgag
cacaggaatctacagaatctgttgatcctgactgccatcaaggcagaccgcacacgggtc
atggagtacatcagccgcctggacaactatgacgcactggacatcgcgagcatcgctgtc
agcagcgcactgtatgaggaggccttcaccgttttccacaagtttgatatgaatgcctca
gcaatccaggtcctgatcgagcacattggaaacctggaccgggcatatgagtttgcggag
agatgcaatgagcctgctgtgtggagtcagctggcccaagcccagctccagaaagatttg
gtgaaggaagccatcaactcctatatcagaggggacgacccttcctcttacctggaagtt
gttcagtcagccagcaggagcaacaactgggaggatctagttaaatttctgcagatggcc
aggaaaaagggccgtgagtcctatatagagactgaacttatttttgccttggctaaaacc
agccgtgtttctgagctagaagattttattaatggacccaacaatgcccacatccagcag
gttggagaccgctgttacgaggagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacgtggaaggaggtgtgctttgcctgc
atggatggacaagagttccgcttcgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgtggctactttgaggagctgatc
ttgctgttggaagcggccctgggcctggagcgggcccacatgggcatgttcactgagctg
gccatcctctactccaaattcaagccacagaagatgctggagcatctggagcttttctgg
tcccgtgtcaacatcccaaaggtgctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtatgacaatgctgtgctcaccatgatgagc
caccccactgaggcctggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gtcgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacctgctgctggtgctttcaccccggctggaccacacctggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcactcaaccacctgctgacagaggaggaggactatcagggctta
agggcatctatcgatgcctatgacaactttgacaacatcagcctggctcagcagctggag
aagcatcagctgatggagttcaggtgcattgcggcctatctgtacaagggcaataactgg
tgggcccagagcgtggagctctgcaagaaggatcatctctacaaggatgccatgcagcat
gctgcagagtcgcgggatgctgagctggcccagaagttgctgcagtggttcctggaggaa
ggcaagagggagtgcttcgcagcttgtctcttcacctgctatgacctgcttcgcccagac
atggtgcttgagctggcctggaggcacaacctcgtggacttggccatgccctacttcatc
caggtgatgagggagtacctgagcaaggtggacaaactggatgccttggagagtctgcgc
aagcaagaggagcatgtgacagagcctgcccctctcgtgtttgattttgatgggcatgaa
tga

DBGET integrated database retrieval system