KEGG   Homo sapiens (human): 8218Help
Entry
8218              CDS       T01001                                 

Gene name
CLTCL1, CHC22, CLH22, CLTCL, CLTD
Definition
(RefSeq) clathrin heavy chain like 1
  KO
K04646  clathrin heavy chain
Organism
hsa  Homo sapiens (human)
Pathway
hsa04142  Lysosome
hsa04144  Endocytosis
hsa04721  Synaptic vesicle cycle
hsa04961  Endocrine and other factor-regulated calcium reabsorption
hsa05016  Huntington disease
hsa05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    8218 (CLTCL1)
   04142 Lysosome
    8218 (CLTCL1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    8218 (CLTCL1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    8218 (CLTCL1)
 09160 Human Diseases
  09163 Neurodegenerative diseases
   05016 Huntington disease
    8218 (CLTCL1)
  09167 Infectious diseases
   05100 Bacterial invasion of epithelial cells
    8218 (CLTCL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8218 (CLTCL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8218 (CLTCL1)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    8218 (CLTCL1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Proteins found in most exosomes
   8218 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD
Motif
Other DBs
NCBI-GeneID: 8218
NCBI-ProteinID: NP_009029
OMIM: 601273
HGNC: 2093
Ensembl: ENSG00000070371
Vega: OTTHUMG00000150109
Pharos: P53675(Tbio)
UniProt: P53675
Position
22q11.21
AA seq 1640 aa AA seqDB search
MAQILPVRFQEHFQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVTIIDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKAHTMAEEVIFWKWVSVNTVA
LVTETAVYHWSMEGDSQPMKMFDRHTSLVGCQVIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKMEGNAKPATLFCFAVRNPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQNDFPVAMQIGAKHGVIYLITKYGYLHLYDLESGVCICMNRISA
DTIFVTAPHKPTSGIIGVNKKGQVLSVCVEEDNIVNYATNVLQNPDLGLRLAVRSNLAGA
EKLFVRKFNTLFAQGSYAEAAKVAASAPKGILRTRETVQKFQSIPAQSGQASPLLQYFGI
LLDQGQLNKLESLELCHLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTTDPMLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRGVMKISPEQGLQFSRMLVQDE
EPLANISQIVDIFMENSLIQQCTSFLLDALKNNRPAEGLLQTWLLEMNLVHAPQVADAIL
GNKMFTHYDRAHIAQLCEKAGLLQQALEHYTDLYDIKRAVVHTHLLNPEWLVNFFGSLSV
EDSVECLHAMLSANIRQNLQLCVQVASKYHEQLGTQALVELFESFKSYKGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESSCYNPERVKNFLKEAKLTDQLPLIIVCDR
FGFVHDLVLYLYRNNLQRYIEIYVQKVNPSRTPAVIGGLLDVDCSEEVIKHLIMAVRGQF
STDELVAEVEKRNRLKLLLPWLESQIQEGCEEPATHNALAKIYIDSNNSPECFLRENAYY
DSSVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVCRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETRDPEEISVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDALDIASIAVSSALYEEAFTVFHKFDMNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLAQAQLQKDLVKEAINSYIRGDDPSSYLEV
VQSASRSNNWEDLVKFLQMARKKGRESYIETELIFALAKTSRVSELEDFINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSNVSNFARLASTLVHLGEYQAAVDNSRKASSTRTWKEVCFAC
MDGQEFRFAQLCGLHIVIHADELEELMCYYQDRGYFEELILLLEAALGLERAHMGMFTEL
AILYSKFKPQKMLEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMMS
HPTEAWKEGQFKDIITKVANVELCYRALQFYLDYKPLLINDLLLVLSPRLDHTWTVSFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNISLAQQLE
KHQLMEFRCIAAYLYKGNNWWAQSVELCKKDHLYKDAMQHAAESRDAELAQKLLQWFLEE
GKRECFAACLFTCYDLLRPDMVLELAWRHNLVDLAMPYFIQVMREYLSKVDKLDALESLR
KQEEHVTEPAPLVFDFDGHE
NT seq 4923 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccctgttcgctttcaggagcacttccagctccaaaaccttggaatt
aatccagctaacattggattcagcacactgaccatggaatctgacaagttcatatgtatc
cgagagaaagttggtgagcaggcacaggtcacgatcattgacatgagtgacccaatggct
ccgatccgacggcctatctctgcagagagtgccatcatgaatccagcctctaaggtgata
gctctgaaagctgggaagacacttcagatctttaatattgagatgaagagtaaaatgaag
gctcatactatggcagaagaagtgattttctggaaatgggtttctgtgaacactgttgcc
ttggtgaccgagaccgcggtctaccactggagcatggaaggtgactcccagcccatgaag
atgtttgatagacataccagtctggtgggctgccaggtgattcactaccggactgatgag
taccagaagtggctgctgctcgtaggcatctcggctcagcaaaaccgtgtggttggagca
atgcagctctactctgtggataggaaggtttcacaacccatagaaggccatgctgcggct
tttgcagagttcaagatggaggggaatgccaagcctgccacccttttctgctttgctgta
cgtaatcccacaggaggcaagttgcacatcattgaagttggacagcctgcagcgggaaac
caaccttttgtaaagaaagcagtagatgtgttttttcctccagaggcacagaatgatttt
ccagtggctatgcagattggagctaaacatggtgttatttacttgatcacaaagtatggc
tatcttcatctgtacgacctagagtctggcgtgtgcatctgcatgaaccgtattagtgct
gacacaatatttgtcactgctccacacaaaccaacctctggaattattggtgtcaacaaa
aagggacaggtactgtcagtttgtgttgaggaagataacattgtgaattatgcaaccaac
gtgcttcagaatccagaccttggtctgcgtttggccgttcgtagtaacctggctggggca
gagaagttgtttgtgagaaaattcaataccctctttgcacagggcagctatgctgaagcc
gccaaagttgcagcgtctgcaccaaagggaatcctgcgtaccagagagacggtccagaaa
ttccagagtatacccgctcagtctggccaggcttctccattgctgcagtacttcggaatc
ctgctcgaccagggtcagctcaataaacttgaatccttagaactttgccatctggttctt
cagcaggggcgtaagcaactcctagagaagtggctgaaagaagataagctggagtgctca
gaggagctcggagacttggtcaaaaccactgaccccatgctcgctctgagtgtgtacctt
cgggcaaatgtgccaagcaaagtgatccagtgttttgcagaaacaggccaattccagaaa
attgtgctctatgccaaaaaggttgggtacaccccagactggatctttctgctgaggggt
gtaatgaagatcagtccggaacagggcctgcagttttctcgaatgctagtgcaggacgag
gagccgctggccaacattagccagattgtggacattttcatggaaaacagtttaattcag
cagtgtacttccttcttattggatgccttgaagaataatcgcccagctgagggactcctg
cagacatggctgttggagatgaaccttgttcatgcaccccaggttgcagatgccatcctt
ggaaataaaatgtttactcattacgaccgggcccacattgcccagctctgtgagaaggca
ggcctcctgcagcaagcactggagcactacaccgacctctatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggcttgtcaatttctttggctccttatcggtg
gaggattctgtggagtgtctgcatgccatgctgtctgctaacatcagacagaaccttcag
ctgtgtgtgcaggtggcctctaagtaccacgagcagctgggcacgcaggccctggtggag
ctctttgaatccttcaagagttacaaaggcctcttctacttcctgggctcaatcgtgaac
ttcagccaagacccagatgtgcatctgaaatacattcaggctgcctgtaagacagggcag
atcaaggaggtggagaggatatgccgagagagcagctgctacaacccagagcgtgtgaag
aacttcctgaaggaggccaagctcacagaccagcttcccctcatcatcgtgtgtgatcgt
tttggctttgtccatgaccttgtcctatatttataccgcaacaacctgcagaggtacatt
gagatctacgtgcagaaggtcaaccctagccggaccccagctgtgattggagggctgctt
gatgtggattgttctgaggaagtgattaaacacttaatcatggcagtgagaggacagttc
tctactgatgagttggtggctgaagtagaaaaaagaaataggctcaagctgctgcttccc
tggctggagtcccagattcaggaaggctgtgaggagcctgccactcacaatgcactggct
aaaatctacatcgacagcaacaacagccccgagtgcttcctgagagagaatgcctactat
gacagcagcgtggtgggccgctactgtgagaagcgagacccccatctggcctgtgttgcc
tatgagcgggggcagtgtgaccttgagctcatcaaggtgtgcaatgagaattctctgttc
aaaagcgaggcccgctacctggtatgcagaaaggatccggagctctgggctcacgtcctt
gaggagaccaacccatccaggagacagctaattgaccaggtggtacagacagcattgtca
gaaacacgggatcctgaagagatttcggtcactgtcaaagcctttatgacagccgacctg
cctaatgaactgattgaactgctggagaagatagttctggataactctgtcttcagcgag
cacaggaatctacagaatctgttgatcctgactgccatcaaggcagaccgcacacgggtc
atggagtacatcagccgcctggacaactatgacgcactggacatcgcgagcatcgctgtc
agcagcgcactgtatgaggaggccttcaccgttttccacaagtttgatatgaatgcctca
gcaatccaggtcctgatcgagcacattggaaacctggaccgggcatatgagtttgcggag
agatgcaatgagcctgctgtgtggagtcagctggcccaagcccagctccagaaagatttg
gtgaaggaagccatcaactcctatatcagaggggacgacccttcctcttacctggaagtt
gttcagtcagccagcaggagcaacaactgggaggatctagttaaatttctgcagatggcc
aggaaaaagggccgtgagtcctatatagagactgaacttatttttgccttggctaaaacc
agccgtgtttctgagctagaagattttattaatggacccaacaatgcccacatccagcag
gttggagaccgctgttacgaggagggaatgtacgaggctgccaagctgctctatagcaat
gtttctaactttgcccgcctggcttccaccttggttcacctcggtgagtatcaggcagca
gtggacaacagccgcaaggccagcagcacccggacgtggaaggaggtgtgctttgcctgc
atggatggacaagagttccgcttcgcacagctgtgtggtcttcacatcgtcattcatgca
gatgagctggaggagctgatgtgctattaccaggatcgtggctactttgaggagctgatc
ttgctgttggaagcggccctgggcctggagcgggcccacatgggcatgttcactgagctg
gccatcctctactccaaattcaagccacagaagatgctggagcatctggagcttttctgg
tcccgtgtcaacatcccaaaggtgctgagggctgcagagcaggcacacctgtgggctgag
ctggtgttcctctatgacaagtacgaggagtatgacaatgctgtgctcaccatgatgagc
caccccactgaggcctggaaggagggtcagttcaaggacatcattaccaaggttgccaac
gtcgagctctgttacagagccctgcagttctatttggattacaaaccactgctcatcaat
gacctgctgctggtgctttcaccccggctggaccacacctggacagtcagtttcttttca
aaggcaggtcagctgcccctggtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggcactcaaccacctgctgacagaggaggaggactatcagggctta
agggcatctatcgatgcctatgacaactttgacaacatcagcctggctcagcagctggag
aagcatcagctgatggagttcaggtgcattgcggcctatctgtacaagggcaataactgg
tgggcccagagcgtggagctctgcaagaaggatcatctctacaaggatgccatgcagcat
gctgcagagtcgcgggatgctgagctggcccagaagttgctgcagtggttcctggaggaa
ggcaagagggagtgcttcgcagcttgtctcttcacctgctatgacctgcttcgcccagac
atggtgcttgagctggcctggaggcacaacctcgtggacttggccatgccctacttcatc
caggtgatgagggagtacctgagcaaggtggacaaactggatgccttggagagtctgcgc
aagcaagaggagcatgtgacagagcctgcccctctcgtgtttgattttgatgggcatgaa
tga

DBGET integrated database retrieval system