KEGG   Homo sapiens (human): 8225Help
Entry
8225              CDS       T01001                                 

Gene name
GTPBP6, PGPL
Definition
(RefSeq) GTP binding protein 6 (putative)
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: GTP-bdg_M GTP-bdg_N MMR_HSR1 FeoB_N AAA_16 Dynamin_N TniB MobB PduV-EutP ABC_tran AAA_14
Motif
Other DBs
NCBI-GeneID: 8225
NCBI-ProteinID: NP_036359
OMIM: 300124
HGNC: 30189
Ensembl: ENSG00000178605
Vega: OTTHUMG00000022694
Pharos: O43824(Tdark)
UniProt: O43824
Position
Xp22.33 and Yp11.31
AA seq 516 aa AA seqDB search
MWALRAAVRPGLRLSRVGRGRSAPRAAAPSCPARALAAVGRRSPGNLEGPWGGGRGLRAD
GGRSRTGDDEEEPEDADENAEEELLRGEPLLPAGTQRVCLVHPDVKWGPGKSQMTRAEWQ
VAEATALVHTLDGWSVVQTMVVSTKTPDRKLIFGKGNFEHLTEKIRGSPDITCVFLNVER
MAAPTKKELEAAWGVEVFDRFTVVLHIFRCNARTKEARLQVALAEMPLHRSNLKRDVAHL
YRGVGSRYIMGSGESFMQLQQRLLREKEAKIRKALDRLRKKRHLLRRQRTRREFPVISVV
GYTNCGKTTLIKALTGDAAIQPRDQLFATLDVTAHAGTLPSRMTVLYVDTIGFLSQLPHG
LIESFSATLEDVAHSDLILHVRDVSHPEAELQKCSVLSTLRGLQLPAPLLDSMVEVHNKV
DLVPGYSPTEPNVVPVSALRGHGLQELKAELDAAVLKATGRQILTLRVRLAGAQLSWLYK
EATVQEVDVIPEDGAADVRVIISNSAYGKFRKLFPG
NT seq 1551 nt NT seq  +upstreamnt  +downstreamnt
atgtgggccctgcgggccgccgtacgcccggggctgcggctctcccgcgtgggccgcggc
cgctcggctccgcgggcagccgcgccgtcctgccccgcgcgcgcgctagccgctgtcggc
cgcaggagccccgggaatctggaggggccgtggggcggagggcggggcctgcgggcggac
ggcggccgaagccgcacgggagacgacgaggaggagccggaagatgcggacgagaacgcc
gaggaggagctgctgcggggagagcctctgctgccggcggggacccagcgcgtgtgtctg
gttcaccctgacgtcaagtggggcccggggaagtcgcagatgactcgagccgagtggcag
gtggcggaggccacagcgctggtgcacacgctggacggctggtccgtggtgcagacaatg
gtcgtgtccaccaaaacgccggacaggaagctcatctttggcaaagggaactttgagcac
ctgacagaaaagatccgagggtctccagacatcacgtgcgtcttcctgaacgtggagagg
atggctgccccgaccaagaaagaactggaagccgcctggggcgtggaggtgtttgaccgc
ttcacggtcgtcctgcacatcttccgctgtaacgcccgcacgaaggaggcccggcttcag
gtggccctggcggagatgccgctgcacaggtcgaacttgaaaagggacgtcgcccacctg
taccgaggagtcggctcgcgctacatcatggggtcaggagaatccttcatgcagctgcag
cagcgtctcctgagagagaaggaggccaagatcaggaaggccttggacaggcttcgcaag
aagaggcacctgctccgccggcagcggacgaggcgggagttccccgtgatctccgtggtg
gggtacaccaactgcggaaagaccacgctgatcaaggcactgacgggcgatgccgccatc
cagccacgggaccagctgtttgccacgctggacgtcacggcccacgcgggcacgctgccc
tcacgcatgaccgtcctgtacgtggacaccatcggcttcctctcccagctgccgcacggc
ctcatcgagtccttctccgccaccctggaagacgtggcccactcggatctcatcttgcac
gtgagggacgtcagccaccccgaggcggagctccagaaatgcagcgttctgtccacgctg
cgtggcctgcagctgcccgccccgctcctggactccatggtggaggttcacaacaaggtg
gacctcgtgcccgggtacagccccacggaaccgaacgtcgtgcccgtgtctgccctgcgg
ggccacgggctccaggagctgaaagctgagctcgatgcggcggttttgaaggcgacgggg
agacagatcctcactctccgtgtgaggctcgcaggggcgcagctcagctggctgtataag
gaggccacagttcaggaggtggacgtgatccctgaggacggggcggccgacgtgagggtc
atcatcagcaactcagcctacggcaaattccggaagctctttccaggatga

DBGET integrated database retrieval system