KEGG   Homo sapiens (human): 823Help
Entry
823               CDS       T01001                                 

Gene name
CAPN1, CANP, CANP1, CANPL1, SPG76, muCANP, muCL
Definition
(RefSeq) calpain 1
  KO
K01367  calpain-1 [EC:3.4.22.52]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa05010  Alzheimer disease
hsa05131  Shigellosis
Disease
H00266  Hereditary spastic paraplegia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    823 (CAPN1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    823 (CAPN1)
   04217 Necroptosis
    823 (CAPN1)
   04218 Cellular senescence
    823 (CAPN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    823 (CAPN1)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    823 (CAPN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    823 (CAPN1)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.52  calpain-1
     823 (CAPN1)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   823 (CAPN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_8 EF-hand_1 EF-hand_6 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 823
NCBI-ProteinID: NP_001185797
OMIM: 114220
HGNC: 1476
Ensembl: ENSG00000014216
Vega: OTTHUMG00000165614
Pharos: P07384(Tchem)
UniProt: P07384 B2RDI5
Structure
PDB: 

Position
11q13.1
AA seq 714 aa AA seqDB search
MSEEIITPVYCTGVSAQVQKQRARELGLGRHENAIKYLGQDYEQLRVRCLQSGTLFRDEA
FPPVPQSLGYKDLGPNSSKTYGIKWKRPTELLSNPQFIVDGATRTDICQGALGDCWLLAA
IASLTLNDTLLHRVVPHGQSFQNGYAGIFHFQLWQFGEWVDVVVDDLLPIKDGKLVFVHS
AEGNEFWSALLEKAYAKVNGSYEALSGGSTSEGFEDFTGGVTEWYELRKAPSDLYQIILK
ALERGSLLGCSIDISSVLDMEAITFKKLVKGHAYSVTGAKQVNYRGQVVSLIRMRNPWGE
VEWTGAWSDSSSEWNNVDPYERDQLRVKMEDGEFWMSFRDFMREFTRLEICNLTPDALKS
RTIRKWNTTLYEGTWRRGSTAGGCRNYPATFWVNPQFKIRLDETDDPDDYGDRESGCSFV
LALMQKHRRRERRFGRDMETIGFAVYEVPPELVGQPAVHLKRDFFLANASRARSEQFINL
REVSTRFRLPPGEYVVVPSTFEPNKEGDFVLRFFSEKSAGTVELDDQIQANLPDEQVLSE
EEIDENFKALFRQLAGEDMEISVKELRTILNRIISKHKDLRTKGFSLESCRSMVNLMDRD
GNGKLGLVEFNILWNRIRNYLSIFRKFDLDKSGSMSAYEMRMAIESAGFKLNKKLYELII
TRYSEPDLAVDFDNFVCCLVRLETMFRFFKTLDTDLDGVVTFDLFKWLQLTMFA
NT seq 2145 nt NT seq  +upstreamnt  +downstreamnt
atgtcggaggagatcatcacgccggtgtactgcactggggtgtcagcccaagtgcagaag
cagcgggccagggagctgggcctgggccgccatgagaatgccatcaagtacctgggccag
gattatgagcagctgcgggtgcgatgcctgcagagtgggaccctcttccgtgatgaggcc
ttccccccggtaccccagagcctgggttacaaggacctgggtcccaattcctccaagacc
tatggcatcaagtggaagcgtcccacggaactgctgtcaaacccccagttcattgtggat
ggagctacccgcacagacatctgccagggagcactgggggactgctggctcttggcggcc
atcgcctccctcactctcaacgacaccctcctgcaccgagtggttccgcacggccagagc
ttccagaatggctatgccggcatcttccatttccagctgtggcaatttggggagtgggtg
gacgtggtcgtggatgacctgctgcccatcaaggacgggaagctagtgttcgtgcactct
gccgaaggcaacgagttctggagcgccctgcttgagaaggcctatgccaaggtaaatggc
agctacgaggccctgtcagggggcagcacctcagagggctttgaggacttcacaggcggg
gttaccgagtggtacgagttgcgcaaggctcccagtgacctctaccagatcatcctcaag
gcgctggagcggggctccctgctgggctgctccatagacatctccagcgttctagacatg
gaggccatcactttcaagaagttggtgaagggccatgcctactctgtgaccggggccaag
caggtgaactaccgaggccaggtggtgagcctgatccggatgcggaacccctggggcgag
gtggagtggacgggagcctggagcgacagctcctcagagtggaacaacgtggacccatat
gaacgggaccagctccgggtcaagatggaggacggggagttctggatgtcattccgagac
ttcatgcgggagttcacccgcctggagatctgcaacctcacacccgacgccctcaagagc
cggaccatccgcaaatggaacaccacactctacgaaggcacctggcggcgggggagcacc
gcggggggctgccgaaactacccagccaccttctgggtgaaccctcagttcaagatccgg
ctggatgagacggatgacccggacgactacggggaccgcgagtcaggctgcagcttcgtg
ctcgcccttatgcagaagcaccgtcgccgcgagcgccgcttcggccgcgacatggagact
attggcttcgcggtctacgaggtccctccggagctggtgggccagccggccgtacacttg
aagcgtgacttcttcctggccaatgcgtctcgggcgcgctcagagcagttcatcaacctg
cgagaggtcagcacccgcttccgcctgccacccggggagtatgtggtggtgccctccacc
ttcgagcccaacaaggagggcgacttcgtgctgcgcttcttctcagagaagagtgctggg
actgtggagctggatgaccagatccaggccaatctccccgatgagcaagtgctctcagaa
gaggagattgacgagaacttcaaggccctcttcaggcagctggcaggggaggacatggag
atcagcgtgaaggagttgcggacaatcctcaataggatcatcagcaaacacaaagacctg
cggaccaagggcttcagcctagagtcgtgccgcagcatggtgaacctcatggatcgtgat
ggcaatgggaagctgggcctggtggagttcaacatcctgtggaaccgcatccggaattac
ctgtccatcttccggaagtttgacctggacaagtcgggcagcatgagtgcctacgagatg
cggatggccattgagtcggcaggcttcaagctcaacaagaagctgtacgagctcatcatc
acccgctactcggagcccgacctggcggtcgactttgacaatttcgtttgctgcctggtg
cggctagagaccatgttccgatttttcaaaactctggacacagatctggatggagttgtg
acctttgacttgtttaagtggttgcagctgaccatgtttgcatga

KEGG   Homo sapiens (human): 824Help
Entry
824               CDS       T01001                                 

Gene name
CAPN2, CANP2, CANPL2, CANPml, mCANP
Definition
(RefSeq) calpain 2
  KO
K03853  calpain-2 [EC:3.4.22.53]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04141  Protein processing in endoplasmic reticulum
hsa04210  Apoptosis
hsa04217  Necroptosis
hsa04218  Cellular senescence
hsa04510  Focal adhesion
hsa05010  Alzheimer disease
hsa05131  Shigellosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    824 (CAPN2)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    824 (CAPN2)
   04217 Necroptosis
    824 (CAPN2)
   04218 Cellular senescence
    824 (CAPN2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    824 (CAPN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    824 (CAPN2)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    824 (CAPN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    824 (CAPN2)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.53  calpain-2
     824 (CAPN2)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   824 (CAPN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 824
NCBI-ProteinID: NP_001739
OMIM: 114230
HGNC: 1479
Ensembl: ENSG00000162909
Vega: OTTHUMG00000037376
Pharos: P17655(Tchem)
UniProt: P17655 Q59EF6
Structure
PDB: 

Position
1q41
AA seq 700 aa AA seqDB search
MAGIAAKLAKDREAAEGLGSHDRAIKYLNQDYEALRNECLEAGTLFQDPSFPAIPSALGF
KELGPYSSKTRGIEWKRPTEICADPQFIIGGATRTDICQGALGDCWLLAAIASLTLNEEI
LARVVPLNQSFQENYAGIFHFQFWQYGEWVEVVVDDRLPTKDGELLFVHSAEGSEFWSAL
LEKAYAKINGCYEALSGGATTEGFEDFTGGIAEWYELKKPPPNLFKIIQKALQKGSLLGC
SIDITSAADSEAITFQKLVKGHAYSVTGAEEVESNGSLQKLIRIRNPWGEVEWTGRWNDN
CPSWNTIDPEERERLTRRHEDGEFWMSFSDFLRHYSRLEICNLTPDTLTSDTYKKWKLTK
MDGNWRRGSTAGGCRNYPNTFWMNPQYLIKLEEEDEDEEDGESGCTFLVGLIQKHRRRQR
KMGEDMHTIGFGIYEVPEELSGQTNIHLSKNFFLTNRARERSDTFINLREVLNRFKLPPG
EYILVPSTFEPNKDGDFCIRVFSEKKADYQAVDDEIEANLEEFDISEDDIDDGFRRLFAQ
LAGEDAEISAFELQTILRRVLAKRQDIKSDGFSIETCKIMVDMLDSDGSGKLGLKEFYIL
WTKIQKYQKIYREIDVDRSGTMNSYEMRKALEEAGFKMPCQLHQVIVARFADDQLIIDFD
NFVRCLVRLETLFKIFKQLDPENTGTIELDLISWLCFSVL
NT seq 2103 nt NT seq  +upstreamnt  +downstreamnt
atggcgggcatcgcggccaagctggcgaaggaccgggaggcggccgaggggctgggctcc
cacgacagggccatcaagtacctcaaccaggactacgaggcgctgcggaacgagtgcctg
gaggccgggacgctcttccaggacccgtccttcccggccatcccctcggccctgggcttc
aaggagttggggccctactccagcaaaacccggggcatcgagtggaagcgccccacggag
atctgcgctgacccccagtttatcattggaggagccacccgcacagacatctgccaagga
gccctgggtgactgctggctgctggcagccattgcctccctcaccttgaatgaagaaatc
ctggctcgagtcgtccccctaaaccagagcttccaggaaaactatgcagggatctttcac
ttccagttctggcaatacggcgagtgggtggaggtggtggtggatgacaggctgcccacc
aaggacggggagctgctctttgtgcattcagccgaagggagcgagttctggagcgccctg
ctggagaaggcatacgccaagatcaacggatgctatgaagcgctatcagggggtgccacc
actgagggcttcgaagacttcaccggaggcattgctgagtggtatgagttgaagaagccc
cctcccaacctgttcaagatcatccagaaagctctgcaaaaaggctctctccttggctgc
tccatcgacatcaccagcgccgcggactcggaggccatcacgtttcagaagctggtgaag
gggcacgcgtactcggtcaccggagccgaggaggttgaaagtaacggaagcctacagaaa
ctgatccgcatccgaaatccctggggagaagtggagtggacagggcggtggaatgacaac
tgcccaagctggaacactatagacccagaggagagggaaaggctgaccagacggcatgaa
gatggagaattctggatgtctttcagtgacttcctgaggcactattcccgcctggagatc
tgtaacctgaccccagacactctcaccagcgatacctacaagaagtggaaactcaccaaa
atggatgggaactggaggcggggctccaccgcgggaggttgcaggaactacccgaacaca
ttctggatgaaccctcagtacctgatcaagctggaggaggaggatgaggacgaggaggat
ggggagagcggctgcaccttcctggtggggctcattcagaagcaccgacggcggcagagg
aagatgggcgaggacatgcacaccatcggctttggcatctatgaggttccagaggagtta
agtgggcagaccaacatccacctcagcaaaaacttcttcctgacgaatcgcgccagggag
cgctcagacaccttcatcaacctccgggaggtgctcaaccgcttcaagctgccgccagga
gagtacattctcgtgccttccaccttcgaacccaacaaggatggggatttctgcatccgg
gtcttttctgaaaagaaagctgactaccaagctgtcgatgatgaaatcgaggccaatctt
gaagagttcgacatcagcgaggatgacattgatgatggattcaggagactgtttgcccag
ttggcaggagaggatgcggagatctctgcctttgagctgcagaccatcctgagaagggtt
ctagcaaagcgccaagatatcaagtcagatggcttcagcatcgagacatgcaaaattatg
gttgacatgctagattcggacgggagtggcaagctggggctgaaggagttctacattctc
tggacgaagattcaaaaataccaaaaaatttaccgagaaatcgacgttgacaggtctggt
accatgaattcctatgaaatgcggaaggcattagaagaagcaggtttcaagatgccctgt
caactccaccaagtcatcgttgctcggtttgcagatgaccagctcatcatcgattttgat
aattttgttcggtgtttggttcggctggaaacgctattcaagatatttaagcagctggat
cccgagaatactggaacaatagagctcgaccttatctcttggctctgtttctcagtactt
tga

DBGET integrated database retrieval system