KEGG   Homo sapiens (human): 8233
Entry
8233              CDS       T01001                                 
Symbol
ZRSR2, U2AF1-RS2, U2AF1L2, U2AF1RS2, URP, ZC3H22
Name
(RefSeq) zinc finger CCCH-type, RNA binding motif and serine/arginine rich 2
  KO
K24273  U2 small nuclear ribonucleoprotein auxiliary factor 35 kDa subunit-related protein
Organism
hsa  Homo sapiens (human)
Disease
H01481  Myelodysplastic syndrome
H02410  Myelodysplastic/myeloproliferative neoplasms
H02411  Chronic myelomonocytic leukemia
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:hsa03041]
    8233 (ZRSR2)
Spliceosome [BR:hsa03041]
 Complex A
  U2 snRNP components
   U2 related factors
    8233 (ZRSR2)
 Complex B
    8233 (ZRSR2)
SSDB
Motif
Pfam: zf-CCCH RRM_1 zf_CCCH_4 zf-CCCH_4 zf-CCCH_2
Other DBs
NCBI-GeneID: 8233
NCBI-ProteinID: NP_005080
OMIM: 300028
HGNC: 23019
Ensembl: ENSG00000169249
Pharos: Q15696(Tbio)
UniProt: Q15696
Position
X:15790484..15823260
AA seq 482 aa
MAAPEKMTFPEKPSHKKYRAALKKEKRKKRRQELARLRDSGLSQKEEEEDTFIEEQQLEE
EKLLERERQRLHEEWLLREQKAQEEFRIKKEKEEAAKKRQEEQERKLKEQWEEQQRKERE
EEEQKRQEKKEKEEALQKMLDQAENELENGTTWQNPEPPVDFRVMEKDRANCPFYSKTGA
CRFGDRCSRKHNFPTSSPTLLIKSMFTTFGMEQCRRDDYDPDASLEYSEEETYQQFLDFY
EDVLPEFKNVGKVIQFKVSCNLEPHLRGNVYVQYQSEEECQAALSLFNGRWYAGRQLQCE
FCPVTRWKMAICGLFEIQQCPRGKHCNFLHVFRNPNNEFWEANRDIYLSPDRTGSSFGKN
SERRERMGHHDDYYSRLRGRRNPSPDHSYKRNGESERKSSRHRGKKSHKRTSKSRERHNS
RSRGRNRDRSRDRSRGRGSRSRSRSRSRRSRRSRSQSSSRSRSRGRRRSGNRDRTVQSPK
SK
NT seq 1449 nt   +upstreamnt  +downstreamnt
atggctgcgcccgagaagatgacgtttcccgagaaaccaagccacaaaaagtacagggcc
gccctgaagaaggagaaacgaaagaaacgtcggcaggaacttgctcgactgagagactca
ggactctcacagaaggaggaagaggaggacacttttattgaagaacaacaactagaagaa
gagaagctattggaaagagagaggcaaagattacatgaggagtggttgctaagagagcag
aaggcacaagaagaattcagaataaagaaggaaaaggaagaggcggctaaaaaacggcaa
gaagaacaagagagaaagttaaaggaacaatgggaagaacagcagaggaaagagagagaa
gaggaggagcagaaacgacaggagaagaaagaaaaagaggaagctttgcagaagatgctg
gatcaggctgaaaatgagttggaaaatggtaccacatggcaaaacccagaaccacccgtg
gatttcagagtaatggagaaggatcgagctaattgtcccttctacagtaaaacaggagct
tgcagatttggagatagatgttcacgtaaacataatttcccaacatccagtcctaccctt
cttattaagagcatgtttacgacgtttggaatggagcagtgcaggagggatgactatgac
cctgacgcaagcctggagtacagcgaggaagaaacctaccaacagttcctagacttctat
gaggatgtgttgcccgagttcaagaacgtggggaaagtgattcagttcaaggtcagctgc
aatttggaacctcacctgaggggcaatgtatatgttcagtaccagtcggaagaagaatgc
caagcagccctttctctgtttaacggacgatggtatgcaggacgacagctgcagtgtgaa
ttctgccccgtgacccggtggaaaatggcgatttgtggtttatttgaaatacaacaatgt
ccaagaggaaagcactgcaactttcttcatgtgttcagaaatcccaacaatgaattctgg
gaagctaatagagacatctacttgtctccagatcggactggctcctcctttgggaagaac
tccgaaaggagggagaggatgggccaccacgacgactactacagcaggctgcggggaagg
agaaaccctagtccagaccactcctacaaaagaaatggggaatccgagaggaaaagtagt
cgtcacagggggaagaaatctcacaaacgcacatcaaagagtcgggagaggcacaattca
cgaagcagaggaagaaatagggaccgcagcagggaccgcagccggggccggggcagccgg
agccggagccggagccggagccgcaggagccgccgcagccggagccaaagttcctctagg
tcccgaagtcgtggcaggaggaggtcgggtaatagagacagaactgttcagagtcccaaa
tccaaataa

DBGET integrated database retrieval system