KEGG   Homo sapiens (human): 8242Help
Entry
8242              CDS       T01001                                 

Gene name
KDM5C, DXS1272E, JARID1C, MRX13, MRXJ, MRXSCJ, MRXSJ, SMCX, XE169
Definition
(RefSeq) lysine demethylase 5C
  KO
K11446  [histone H3]-trimethyl-L-lysine4 demethylase [EC:1.14.11.67]
Organism
hsa  Homo sapiens (human)
Disease
H00658  Syndromic X-linked mental retardation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8242 (KDM5C)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8242 (KDM5C)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.67  [histone H3]-trimethyl-L-lysine4 demethylase
     8242 (KDM5C)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8242 (KDM5C)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Histone modification proteins
   Histone demethylases
    8242 (KDM5C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLU-1 JmjC ARID JmjN zf-C5HC2 PHD
Motif
Other DBs
NCBI-GeneID: 8242
NCBI-ProteinID: NP_004178
OMIM: 314690
HGNC: 11114
Ensembl: ENSG00000126012
Vega: OTTHUMG00000021606
Pharos: P41229(Tchem)
UniProt: P41229
Structure
PDB: 

Position
Xp11.22
AA seq 1560 aa AA seqDB search
MEPGSDDFLPPPECPVFEPSWAEFRDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRIQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERRILDLYSLSKIVV
EEGGYEAICKDRRWARVAQRLNYPPGKNIGSLLRSHYERIVYPYEMYQSGANLVQCNTRP
FDNEEKDKEYKPHSIPLRQSVQPSKFNSYGRRAKRLQPDPEPTEEDIEKNPELKKLQIYG
AGPKMMGLGLMAKDKTLRKKDKEGPECPPTVVVKEELGGDVKVESTSPKTFLESKEELSH
SPEPCTKMTMRLRRNHSNAQFIESYVCRMCSRGDEDDKLLLCDGCDDNYHIFCLLPPLPE
IPKGVWRCPKCVMAECKRPPEAFGFEQATREYTLQSFGEMADSFKADYFNMPVHMVPTEL
VEKEFWRLVNSIEEDVTVEYGADIHSKEFGSGFPVSDSKRHLTPEEEEYATSGWNLNVMP
VLEQSVLCHINADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSL
AAEHLEEVMKKLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRA
YHSGFNQGYNFAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAACPEKLDL
NLAAAVHKEMFIMVQEERRLRKALLEKGITEAEREAFELLPDDERQCIKCKTTCFLSALA
CYDCPDGLVCLSHINDLCKCSSSRQYLRYRYTLDELPAMLHKLKVRAESFDTWANKVRVA
LEVEDGRKRSLEELRALESEARERRFPNSELLQQLKNCLSEAEACVSRALGLVSGQEAGP
HRVAGLQMTLTELRAFLDQMNNLPCAMHQIGDVKGVLEQVEAYQAEAREALASLPSSPGL
LQSLLERGRQLGVEVPEAQQLQRQVEQARWLDEVKRTLAPSARRGTLAVMRGLLVAGASV
APSPAVDKAQAELQELLTIAERWEEKAHLCLEARQKHPPATLEAIIREAENIPVHLPNIQ
ALKEALAKARAWIADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHS
WREKASKTFLKKNSCYTLLEVLCPCADAGSDSTKRSRWMEKELGLYKSDTELLGLSAQDL
RDPGSVIVAFKEGEQKEKEGILQLRRTNSAKPSPLASSSTASSTTSICVCGQVLAGAGAL
QCDLCQDWFHGRCVSVPRLLSSPRPNPTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILA
LLVALQRLPVRLPEGEALQCLTERAISWQGRARQALASEDVTALLGRLAELRQRLQAEPR
PEEPPNYPAAPASDPLREGSGKDMPKVQGLLENGDSVTSPEKVAPEEGSGKRDLELLSSL
LPQLTGPVLELPEATRAPLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLERIRTLLEL
EKAERHGSRARGRALERRRRRKVDRGGEGDDPAREELEPKRVRSSGPEAEEVQEEEELEE
ETGGEGPPAPIPTTGSPSTQENQNGLEPAEGTTSGPSAPFSTLTPRLHLPCPQQPPQQQL
NT seq 4683 nt NT seq  +upstreamnt  +downstreamnt
atggagccggggtccgacgatttcctaccgccaccggagtgcccggtgttcgagcctagc
tgggccgagttccgagaccctcttggctacatcgcgaaaatcaggcccatcgcagagaaa
tcgggcatttgcaagatccgcccacccgcggactggcagccaccctttgctgtggaagtg
gacaacttcaggtttaccccccgaatccagaggctgaatgagctagaggcccagacgaga
gtgaaactgaactacttggaccagattgccaaattctgggaaatccagggctcctcctta
aagattcccaatgtagaacggcggatcttggacctctacagtctcagcaaaattgtggtg
gaggaaggtggttatgaagctatctgcaaggaccgtcggtgggctcgggtagcccagcgc
ctcaactatccaccaggcaaaaatattggctccttgctacgctcccactacgaacgcatt
gtttatccctatgaaatgtaccagtctggagccaaccttgtgcagtgtaacacacgtcca
tttgataatgaggagaaggacaaggaatacaaaccccacagcatccccctacgacagtct
gtgcagccttccaagttcaacagctatggccggcgggccaagagactgcagcctgatccg
gaacccacagaggaagacattgagaagaatccagagctgaaaaagctacagatctatggg
gcaggccccaagatgatgggcctgggcctcatggccaaagacaagactctgcggaagaaa
gataaggaggggcctgagtgtccccccacagtagtggtgaaggaggagttaggtggggat
gtgaaggtggagtcaacatcgcctaagaccttcctggagagcaaggaggagctgagtcac
agcccagaaccctgcaccaagatgaccatgaggctacggaggaaccacagcaatgcccag
tttattgagtcatatgtctgccggatgtgttctcgaggggatgaggatgacaagctcctg
ctgtgtgatggctgtgatgacaactaccacatcttctgcctgctgcctcctctgcctgag
atccccaagggtgtctggcggtgcccaaagtgtgtcatggcggagtgtaagcggccccca
gaagcctttggctttgagcaggctacccgggaatacactctgcagagctttggcgagatg
gccgactcctttaaagctgactacttcaacatgcccgtgcatatggtgcccacagaactt
gtggagaaggagttctggaggctggtaaatagcattgaggaagatgtgactgttgagtat
ggagctgacatccattccaaagaatttggcagcggtttccctgtcagtgacagtaaacgg
cacctaacccccgaagaggaggagtatgctaccagtggttggaacctaaatgtgatgccg
gtgttggaacagtctgtactgtgccacatcaatgcagatatctctggcatgaaggtgccc
tggctctacgtgggcatggtcttctcagccttttgctggcatattgaggatcactggagt
tactccattaactacctccactggggtgagccgaagacctggtatggggtgccctcactt
gcagcagaacatttggaagaagtgatgaagaagctgacacctgaactatttgatagccag
cctgacctcctgcaccaacttgtcaccctcatgaatcccaacaccctcatgtcccatggt
gtgccagttgtccgcacaaaccagtgtgcaggagagtttgtcatcaccttcccccgtgct
taccacagcggcttcaaccaaggctacaactttgccgaggctgtcaacttttgcactgct
gactggttgcctgctgggcgccagtgcattgagcactaccgccggctccggagatactgc
gtcttctcccatgaggagcttatctgcaagatggctgcctgcccagagaagctagacctg
aacctggcggcagctgtgcataaggagatgttcatcatggtgcaagaagagcggcgtcta
cgaaaggccctgctggagaagggtatcacagaggctgagcgagaggctttcgagctgctc
ccagatgatgagcgccagtgtatcaagtgcaagactacgtgtttcctgtcagccctggcc
tgctacgactgcccagacggccttgtctgcctttcccacatcaatgatctctgcaagtgc
tccagtagccggcagtacctgcggtatcggtataccttggatgagcttcctgccatgctg
cataagctgaaggttcgggctgagtcctttgacacctgggccaacaaagtgcgagtggcc
ctggaggtggaggatgggcggaagcgcagccttgaagaactgagggcactagagtctgaa
gcccgtgagcggaggtttcctaatagtgagctgctgcagcaactaaagaactgcctgagt
gaggcagaggcttgcgtgtcccgagctctgggactggtcagcggccaggaagctggcccc
cacagggtggctggtctacagatgaccctgactgagctccgggcctttctggaccagatg
aacaacctgccttgcgccatgcaccagattggggatgtcaagggtgttctggaacaggtg
gaggcctaccaggctgaggctcgtgaggccctggcctcactgccctccagtccagggcta
ctgcagtccctgttggagagggggcggcagctgggggtggaggtgcctgaggcccagcag
ctccagcggcaggtggaacaggcgcgatggctggatgaggtgaaacgcacactggccccc
tcagcccgaaggggcaccttggctgtcatgcgaggactgttggtcgcgggtgccagtgta
gcccctagccctgctgtggataaagcccaggccgagctgcaggaactgctgaccattgct
gaacgctgggaggagaaagcccacctctgcctggaggccaggcagaagcatccaccagcc
acacttgaggccataatccgtgaagcggaaaacatccctgttcacctgcccaacatccag
gctctcaaggaggctcttgctaaggcccgggcctggattgctgatgttgatgagatccaa
aatggtgaccactacccctgcctggatgacttggagggcctagtagctgtgggccgggac
ctacctgtggggctggaggagctgagacagctagagctacaggtactgacagcgcactcc
tggagggagaaggcctccaagaccttcctcaagaaaaattcttgctacacgctgctggag
gttctctgcccatgtgcagatgccggctcagacagcaccaagcgcagccggtggatggag
aaggagctggggttgtacaaatctgacacagagctgctggggctgtctgcgcaggacctc
agggacccaggctctgtgatcgtggccttcaaggagggggaacagaaggagaaggagggt
atcctgcagctgcgtcgcaccaattcggccaagcccagtccactggcatcatcgagcacg
gcctcctctacaacctctatctgtgtgtgtgggcaggtgctggctggggcgggagctctg
cagtgtgacctgtgtcaggactggttccatgggcggtgtgtgtcagtgcctcgcctcctc
agctctccgaggcccaatcccacctcatccccactgctggcctggtgggaatgggacacc
aaattcctgtgtccactgtgtatgcgctcaaggcgcccgcgcctggagaccatcctggca
ctgctggtagccctgcagagactgcctgtgcggctgcccgagggcgaggccctgcagtgc
ctcacagagagggccatcagctggcaaggccgcgccaggcaggctctggcctctgaagat
gtgactgctcttttgggacggctggctgagctccgccaacggctacaggctgaacctaga
cctgaggagcctcctaactaccctgcagcccctgcttctgaccccctcagagagggcagt
ggcaaggatatgcctaaggtccagggcttactggagaatggagacagtgtgaccagtcct
gagaaggtagccccggaggagggctcaggtaagagagatctggagctgctgtcctcgctg
ttgccacagttgactggccctgtgttggaactgcctgaggcaacccgggcccccttggag
gagctcatgatggagggggacctgctcgaggtgaccctggatgagaaccacagcatatgg
cagctgctgcaggctggacagcccccagacctggagaggatccgcacacttctggagctg
gagaaggcagagcgtcacgggagtcgggctcggggccgggccctggagaggcggcggcgg
cggaaggtggatcggggtggggagggcgatgacccagcccgagaggagctagagccaaag
agggtacggagctcagggccagaggctgaggaggtccaggaggaggaagagctggaggag
gagactgggggtgagggcccccctgcacccatccccaccactggcagccccagcacccag
gagaaccagaatggcttggaaccggcggaagggaccacttcaggcccctcggcccctttc
tccactctgactccccggctgcatctgccctgcccacagcagccgcctcagcaacagttg
tga

DBGET integrated database retrieval system