KEGG   Homo sapiens (human): 825Help
Entry
825               CDS       T01001                                 

Gene name
CAPN3, CANP3, CANPL3, LGMD2, LGMD2A, nCL-1, p94
Definition
(RefSeq) calpain 3
  KO
K08573  calpain-3 [EC:3.4.22.54]
Organism
hsa  Homo sapiens (human)
Disease
H00592  Calpainopathy
H00593  Limb-girdle muscular dystrophy (LGMD)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:hsa01002]
    825 (CAPN3)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.54  calpain-3
     825 (CAPN3)
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   825 (CAPN3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_C2 Calpain_III Calpain_u2 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_7
Motif
Other DBs
NCBI-GeneID: 825
NCBI-ProteinID: NP_000061
OMIM: 114240
HGNC: 1480
Ensembl: ENSG00000092529
Vega: OTTHUMG00000130619
Pharos: P20807(Tbio)
UniProt: P20807
Structure
PDB: 

Position
15q15.1
AA seq 821 aa AA seqDB search
MPTVISASVAPRTAAEPRSPGPVPHPAQSKATEAGGGNPSGIYSAIISRNFPIIGVKEKT
FEQLHKKCLEKKVLYVDPEFPPDETSLFYSQKFPIQFVWKRPPEICENPRFIIDGANRTD
ICQGELGDCWFLAAIACLTLNQHLLFRVIPHDQSFIENYAGIFHFQFWRYGEWVDVVIDD
CLPTYNNQLVFTKSNHRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVAEFFE
IRDAPSDMYKIMKKAIERGSLMGCSIDDGTNMTYGTSPSGLNMGELIARMVRNMDNSLLQ
DSDLDPRGSDERPTRTIIPVQYETRMACGLVRGHAYSVTGLDEVPFKGEKVKLVRLRNPW
GQVEWNGSWSDRWKDWSFVDKDEKARLQHQVTEDGEFWMSYEDFIYHFTKLEICNLTADA
LQSDKLQTWTVSVNEGRWVRGCSAGGCRNFPDTFWTNPQYRLKLLEEDDDPDDSEVICSF
LVALMQKNRRKDRKLGASLFTIGFAIYEVPKEMHGNKQHLQKDFFLYNASKARSKTYINM
REVSQRFRLPPSEYVIVPSTYEPHQEGEFILRVFSEKRNLSEEVENTISVDRPVKKKKTK
PIIFVSDRANSNKELGVDQESEEGKGKTSPDKQKQSPQPQPGSSDQESEEQQQFRNIFKQ
IAGDDMEICADELKKVLNTVVNKHKDLKTHGFTLESCRSMIALMDTDGSGKLNLQEFHHL
WNKIKAWQKIFKHYDTDQSGTINSYEMRNAVNDAGFHLNNQLYDIITMRYADKHMNIDFD
SFICCFVRLEGMFRAFHAFDKDGDGIIKLNVLEWLQLTMYA
NT seq 2466 nt NT seq  +upstreamnt  +downstreamnt
atgccgaccgtcattagcgcatctgtggctccaaggacagcggctgagccccggtcccca
gggccagttcctcacccggcccagagcaaggccactgaggctgggggtggaaacccaagt
ggcatctattcagccatcatcagccgcaattttcctattatcggagtgaaagagaagaca
ttcgagcaacttcacaagaaatgtctagaaaagaaagttctttatgtggaccctgagttc
ccaccggatgagacctctctcttttatagccagaagttccccatccagttcgtctggaag
agacctccggaaatttgcgagaatccccgatttatcattgatggagccaacagaactgac
atctgtcaaggagagctaggggactgctggtttctcgcagccattgcctgcctgaccctg
aaccagcaccttcttttccgagtcataccccatgatcaaagtttcatcgaaaactacgca
gggatcttccacttccagttctggcgctatggagagtgggtggacgtggttatagatgac
tgcctgccaacgtacaacaatcaactggttttcaccaagtccaaccaccgcaatgagttc
tggagtgctctgctggagaaggcttatgctaagctccatggttcctacgaagctctgaaa
ggtgggaacaccacagaggccatggaggacttcacaggaggggtggcagagttttttgag
atcagggatgctcctagtgacatgtacaagatcatgaagaaagccatcgagagaggctcc
ctcatgggctgctccattgatgatggcacgaacatgacctatggaacctctccttctggt
ctgaacatgggggagttgattgcacggatggtaaggaatatggataactcactgctccag
gactcagacctcgaccccagaggctcagatgaaagaccgacccggacaatcattccggtt
cagtatgagacaagaatggcctgcgggctggtcagaggtcacgcctactctgtcacgggg
ctggatgaggtcccgttcaaaggtgagaaagtgaagctggtgcggctgcggaatccgtgg
ggccaggtggagtggaacggttcttggagtgatagatggaaggactggagctttgtggac
aaagatgagaaggcccgtctgcagcaccaggtcactgaggatggagagttctggatgtcc
tatgaggatttcatctaccatttcacaaagttggagatctgcaacctcacggccgatgct
ctgcagtctgacaagcttcagacctggacagtgtctgtgaacgagggccgctgggtacgg
ggttgctctgccggaggctgccgcaacttcccagatactttctggaccaaccctcagtac
cgtctgaagctcctggaggaggacgatgaccctgatgactcggaggtgatttgcagcttc
ctggtggccctgatgcagaagaaccggcggaaggaccggaagctaggggccagtctcttc
accattggcttcgccatctacgaggttcccaaagagatgcacgggaacaagcagcacctg
cagaaggacttcttcctgtacaacgcctccaaggccaggagcaaaacctacatcaacatg
cgggaggtgtcccagcgcttccgcctgcctcccagcgagtacgtcatcgtgccctccacc
tacgagccccaccaggagggggaattcatcctccgggtcttctctgaaaagaggaacctc
tctgaggaagttgaaaataccatctccgtggatcggccagtgaaaaagaaaaaaaccaag
cccatcatcttcgtttcggacagagcaaacagcaacaaggagctgggtgtggaccaggag
tcagaggagggcaaaggcaaaacaagccctgataagcaaaagcagtccccacagccacag
cctggcagctctgatcaggaaagtgaggaacagcaacaattccggaacattttcaagcag
atagcaggagatgacatggagatctgtgcagatgagctcaagaaggtccttaacacagtc
gtgaacaaacacaaggacctgaagacacacgggttcacactggagtcctgccgtagcatg
attgcgctcatggatacagatggctctggaaagctcaacctgcaggagttccaccacctc
tggaacaagattaaggcctggcagaaaattttcaaacactatgacacagaccagtccggc
accatcaacagctacgagatgcgaaatgcagtcaacgacgcaggattccacctcaacaac
cagctctatgacatcattaccatgcggtacgcagacaaacacatgaacatcgactttgac
agtttcatctgctgcttcgttaggctggagggcatgttcagagcttttcatgcatttgac
aaggatggagatggtatcatcaagctcaacgttctggagtggctgcagctcaccatgtat
gcctga

DBGET integrated database retrieval system