KEGG   Homo sapiens (human): 826Help
Entry
826               CDS       T01001                                 

Gene name
CAPNS1, CALPAIN4, CANP, CANPS, CAPN4, CDPS, CSS1
Definition
(RefSeq) calpain small subunit 1
  KO
K08583  calpain, small subunit 1
Organism
hsa  Homo sapiens (human)
Brite
Peptidases [BR:hsa01002]
 Cysteine Peptidases
  Family C2: calpain family
   826 (CAPNS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 826
NCBI-ProteinID: NP_001003962
OMIM: 114170
HGNC: 1481
Ensembl: ENSG00000126247
Vega: OTTHUMG00000160811
Pharos: P04632(Tbio)
UniProt: P04632
Structure
PDB: 

Position
19q13.12
AA seq 268 aa AA seqDB search
MFLVNSFLKGGGGGGGGGGGLGGGLGNVLGGLISGAGGGGGGGGGGGGGGGGGGGGTAMR
ILGGVISAISEAAAQYNPEPPPPRTHYSNIEANESEEVRQFRRLFAQLAGDDMEVSATEL
MNILNKVVTRHPDLKTDGFGIDTCRSMVAVMDSDTTGKLGFEEFKYLWNNIKRWQAIYKQ
FDTDRSGTICSSELPGAFEAAGFHLNEHLYNMIIRRYSDESGNMDFDNFISCLVRLDAMF
RAFKSLDKDGTGQIQVNIQEWLQLTMYS
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgttcctggttaactcgttcttgaagggcggcggcggcggcggcgggggaggcgggggc
ctgggtgggggcctgggaaatgtgcttggaggcctgatcagcggggccgggggcggcggc
ggcggcggcggcggcggcggcggtggtggaggcggcggtggcggtggaacggccatgcgc
atcctaggcggagtcatcagcgccatcagcgaggcggctgcgcagtacaacccggagccc
ccgcccccacgcacacattactccaacattgaggccaacgagagtgaggaggtccggcag
ttccggagactctttgcccagctggctggagatgacatggaggtcagcgccacagaactc
atgaacattctcaataaggttgtgacacgacaccctgatctgaagactgatggttttggc
attgacacatgtcgcagcatggtggccgtgatggatagcgacaccacaggcaagctgggc
tttgaggaattcaagtacttgtggaacaacatcaaaaggtggcaggccatatacaaacag
ttcgacactgaccgatcagggaccatttgcagtagtgaactcccaggtgcctttgaggca
gcagggttccacctgaatgagcatctctataacatgatcatccgacgctactcagatgaa
agtgggaacatggattttgacaacttcatcagctgcttggtcaggctggacgccatgttc
cgtgccttcaaatctcttgacaaagatggcactggacaaatccaggtgaacatccaggag
tggctgcagctgactatgtattcctga

DBGET integrated database retrieval system