KEGG   Homo sapiens (human): 8260Help
Entry
8260              CDS       T01001                                 

Gene name
NAA10, ARD1, ARD1A, ARD1P, DXS707, MCOPS1, NATD, OGDNS, TE2, hARD1
Definition
(RefSeq) N(alpha)-acetyltransferase 10, NatA catalytic subunit
  KO
K20791  N-alpha-acetyltransferase 10/11 [EC:2.3.1.255]
Organism
hsa  Homo sapiens (human)
Disease
H02170  Microphthalmia, syndromic
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8260 (NAA10)
Enzymes [BR:hsa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.255  N-terminal amino-acid Nalpha-acetyltransferase NatA
     8260 (NAA10)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Sister chromatid cohesion proteins
   Other sister chromatid cohesion factors
    8260 (NAA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 FR47 Acetyltransf_9 Acetyltransf_13 Acetyltransf_15 Acetyltransf_3
Motif
Other DBs
NCBI-GeneID: 8260
NCBI-ProteinID: NP_003482
OMIM: 300013
HGNC: 18704
Ensembl: ENSG00000102030
Vega: OTTHUMG00000024225
Pharos: P41227(Tbio)
UniProt: P41227
Structure
PDB: 

Position
Xq28
AA seq 235 aa AA seqDB search
MNIRNARPEDLMNMQHCNLLCLPENYQMKYYFYHGLSWPQLSYIAEDENGKIVGYVLAKM
EEDPDDVPHGHITSLAVKRSHRRLGLAQKLMDQASRAMIENFNAKYVSLHVRKSNRAALH
LYSNTLNFQISEVEPKYYADGEDAYAMKRDLTQMADELRRHLELKEKGRHVVLGAIENKV
ESKGNSPPSSGEACREEKGLAAEDSGGDSKDLSEVSETTESTDVKDSSEASDSAS
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgaacatccgcaatgcgaggccagaggacctaatgaacatgcagcactgcaacctcctc
tgcctgcccgagaactaccagatgaaatactacttctaccatggcctttcctggccccag
ctctcttacattgctgaggacgagaatgggaagattgtggggtatgtcctggccaaaatg
gaagaggacccagatgatgtgccccatggacatatcacctcattggctgtgaagcgttcc
caccggcgcctcggtctggctcagaaactgatggaccaggcctctcgagccatgatagag
aacttcaatgccaaatatgtctccctgcatgtcaggaagagtaaccgggccgccctgcac
ctctattccaacaccctcaactttcagatcagtgaagtggagcccaaatactatgcagat
ggggaggacgcctatgccatgaagcgggacctcactcagatggccgacgagctgaggcgg
cacctggagctgaaagagaagggcaggcacgtggtgctgggtgccatcgagaacaaggtg
gagagcaaaggcaattcacctccgagctcaggagaggcctgtcgcgaggagaagggcctg
gctgccgaggatagtggtggggacagcaaggacctcagcgaggtcagcgagaccacagag
agcacagatgtcaaggacagctcagaggcctccgactcagcctcctag

DBGET integrated database retrieval system