KEGG   Homo sapiens (human): 8269Help
Entry
8269              CDS       T01001                                 

Gene name
TMEM187, CXorf12, DXS9878E, ITBA1
Definition
(RefSeq) transmembrane protein 187
Organism
hsa  Homo sapiens (human)
SSDB OrthologParalogGFIT
Motif
Pfam: TMEM187
Motif
Other DBs
NCBI-GeneID: 8269
NCBI-ProteinID: NP_003483
OMIM: 300059
HGNC: 13705
Ensembl: ENSG00000177854
Vega: OTTHUMG00000024220
Pharos: Q14656(Tdark)
UniProt: Q14656
Position
Xq28
AA seq 261 aa AA seqDB search
MNPEWGQAFVHVAVAGGLCAVAVFTGIFDSVSVQVGYEHYAEAPVAGLPAFLAMPFNSLV
NMAYTLLGLSWLHRGGAMGLGPRYLKDVFAAMALLYGPVQWLRLWTQWRRAAVLDQWLTL
PIFAWPVAWCLYLDRGWRPWLFLSLECVSLASYGLALLHPQGFEVALGAHVVAAVGQALR
THRHYGSTTSATYLALGVLSCLGFVVLKLCDHQLARWRLFQCLTGHFWSKVCDVLQFHFA
FLFLTHFNTHPRFHPSGGKTR
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaatccagagtgggggcaggccttcgtgcacgtggccgtggccggtggcctctgtgcc
gtggctgtgttcacgggcattttcgacagtgtttccgtgcaagtgggctatgagcactac
gccgaggcgcccgtggccggcctccctgccttcctggccatgccgttcaactcactcgtg
aacatggcctacacgctgctggggctgtcgtggctgcacaggggcggcgcgatggggctg
ggtccccgctacctgaaggacgtgttcgcagccatggccctgctctatggccccgtgcag
tggctgcgcctgtggacgcagtggcgccgtgccgcggtgctggaccagtggctcacactg
cccatctttgcatggcccgtggcctggtgcctctacctagaccgcggctggcggccctgg
ctgttcctctctcttgagtgcgtctccctggccagttatggcctcgctctgctgcatccc
cagggcttcgaggtcgcactgggtgctcacgtggtggccgctgtggggcaggcgctgcgc
acccacaggcactatggcagcaccacctcggctacctacttagctttgggggtgctctct
tgcctgggctttgtggtcctcaagctgtgtgaccatcagctcgcacggtggcgtctcttc
cagtgcctcacaggccacttctggtccaaggtctgtgacgtgctccagttccactttgcg
tttttgtttctgacgcatttcaacactcacccaagattccatccctctggcgggaagacg
cgttga

DBGET integrated database retrieval system