KEGG   Homo sapiens (human): 827
Entry
827               CDS       T01001                                 
Symbol
CAPN6, CANPX, CAPNX, CalpM, DJ914P14.1
Name
(RefSeq) calpain 6
  KO
K08575  calpain-6 [EC:3.4.22.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    827 (CAPN6)
Enzymes [BR:hsa01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.22  Cysteine endopeptidases
    3.4.22.-
     827 (CAPN6)
Peptidases and inhibitors [BR:hsa01002]
 Cysteine peptidases
  Family C2: calpain family
   827 (CAPN6)
SSDB
Motif
Pfam: Peptidase_C2 Calpain_III C2
Other DBs
NCBI-GeneID: 827
NCBI-ProteinID: NP_055104
OMIM: 300146
HGNC: 1483
Ensembl: ENSG00000077274
Pharos: Q9Y6Q1(Tbio)
UniProt: Q9Y6Q1
Position
X:complement(111245099..111270483)
AA seq 641 aa
MGPPLKLFKNQKYQELKQECIKDSRLFCDPTFLPENDSLFYNRLLPGKVVWKRPQDICDD
PHLIVGNISNHQLTQGRLGHKPMVSAFSCLAVQESHWTKTIPNHKEQEWDPQKTEKYAGI
FHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGL
TITDIIVDFTGTLAETVDMQKGRYTELVEEKYKLFGELYKTFTKGGLICCSIESPNQEEQ
EVETDWGLLKGHTYTMTDIRKIRLGERLVEVFSAEKVYMVRLRNPLGRQEWSGPWSEISE
EWQQLTASDRKNLGLVMSDDGEFWMSLEDFCRNFHKLNVCRNVNNPIFGRKELESVLGCW
TVDDDPLMNRSGGCYNNRDTFLQNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYI
IGFELFKVEMNRKFRLHHLYIQERAGTSTYIDTRTVFLSKYLKKGNYVLVPTMFQHGRTS
EFLLRIFSEVPVQLRELTLDMPKMSCWNLARGYPKVVTQITVHSAEDLEKKYANETVNPY
LVIKCGKEEVRSPVQKNTVHAIFDTQAIFYRRTTDIPIIVQVWNSRKFCDQFLGQVTLDA
DPSDCRDLKSLYLRKKGGPTAKVKQGHISFKVISSDDLTEL
NT seq 1926 nt   +upstreamnt  +downstreamnt
atgggtcctcctctgaagctcttcaaaaaccagaaataccaggaactgaagcaggaatgc
atcaaagacagcagacttttctgtgatccaacatttctgcctgagaatgattctcttttc
tacaaccgactgcttcctggaaaggtggtgtggaaacgtccccaggacatctgtgatgac
ccccatctgattgtgggcaacattagcaaccaccagctgacccaagggagactggggcac
aagccaatggtttctgcattttcctgtttggctgttcaggagtctcattggacaaagaca
attcccaaccataaggaacaggaatgggaccctcaaaaaacagaaaaatacgctgggata
tttcactttcgtttctggcattttggagaatggactgaagtggtgattgatgacttgttg
cccaccattaacggagatctggtcttctctttctccacttccatgaatgagttttggaat
gctctgctggaaaaagcttatgcaaagctgctaggctgttatgaggccctggatggtttg
accatcactgatattattgtggacttcacgggcacattggctgaaactgttgacatgcag
aaaggaagatacactgagcttgttgaggagaagtacaagctattcggagaactgtacaaa
acatttaccaaaggtggtctgatctgctgttccattgagtctcccaatcaggaggagcaa
gaagttgaaactgattggggtctgctgaagggccatacctataccatgactgatattcgc
aaaattcgtcttggagagagacttgtggaagtcttcagtgctgagaaggtgtatatggtt
cgcctgagaaaccccttgggaagacaggaatggagtggcccctggagtgaaatttctgaa
gagtggcagcaactgactgcatcagatcgcaagaacctggggcttgttatgtctgatgat
ggagagttttggatgagcttggaggacttttgccgcaactttcacaaactgaatgtctgc
cgcaatgtgaacaaccctatttttggccgaaaggagctggaatcggtgttgggatgctgg
actgtggatgatgatcccctgatgaaccgctcaggaggctgctataacaaccgtgatacc
ttcctgcagaatccccagtacatcttcactgtgcctgaggatgggcacaaggtcattatg
tcactgcagcagaaggacctgcgcacttaccgccgaatgggaagacctgacaattacatc
attggctttgagctcttcaaggtggagatgaaccgcaaattccgcctccaccacctctac
atccaggagcgtgctgggacttccacctatattgacacccgcacagtgtttctgagcaag
tacctgaagaagggcaactatgtgcttgtcccaaccatgttccagcatggtcgcaccagc
gagtttctcctgagaatcttctctgaagtgcctgtccagctcagggaactgactctggac
atgcccaaaatgtcctgctggaacctggctcgtggctacccgaaagtagttactcagatc
actgttcacagtgctgaggacctggagaagaagtatgccaatgaaactgtaaacccatat
ttggtcatcaaatgtggaaaggaggaagtccgttctcctgtccagaagaatacagttcat
gccatttttgacacccaggccattttctacagaaggaccactgacattcctattatagta
caggtctggaacagccgaaaattctgtgatcagttcttggggcaggttactctggatgct
gaccccagcgactgccgtgatctgaagtctctgtacctgcgtaagaagggtggtccaact
gccaaagtcaagcaaggccacatcagcttcaaggttatttccagcgatgatctcactgag
ctctaa

DBGET integrated database retrieval system