KEGG   Homo sapiens (human): 8273Help
Entry
8273              CDS       T01001                                 

Gene name
SLC10A3, DXS253E, P3
Definition
(RefSeq) solute carrier family 10 member 3
  KO
K14343  solute carrier family 10 (sodium/bile acid cotransporter), member 3/5
Organism
hsa  Homo sapiens (human)
Drug target
Maralixibat (DG02832): D10951 D10952
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:hsa02000]
    8273 (SLC10A3)
Transporters [BR:hsa02000]
 Solute Carrier Family (SLC)
  SLC10: Sodium bile salt cotransporter
   8273 (SLC10A3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SBF
Motif
Other DBs
NCBI-GeneID: 8273
NCBI-ProteinID: NP_001135864
OMIM: 312090
HGNC: 22979
Ensembl: ENSG00000126903
Vega: OTTHUMG00000013369
Pharos: P09131(Tdark)
UniProt: P09131
Position
Xq28
AA seq 477 aa AA seqDB search
MVLMQDKGSSQQWPGLGGEGGGTGPLSMLRAALLLISLPWGAQGTASTSLSTAGGHTVPP
TGGRYLSIGDGSVMEFEFPEDSEGIIVISSQYPGQANRTAPGPMLRVTSLDTEVLTIKNV
SAITWGGGGGFVVSIHSGLAGLAPLHIQLVDAHEAPPTLIEERRDFCIKVSPAEDTPATL
SADLAHFSENPILYLLLPLIFVNKCSFGCKVELEVLKGLMQSPQPMLLGLLGQFLVMPLY
AFLMAKVFMLPKALALGLIITCSSPGGGGSYLFSLLLGGDVTLAISMTFLSTVAATGFLP
LSSAIYSRLLSIHETLHVPISKILGTLLFIAIPIAVGVLIKSKLPKFSQLLLQVVKPFSF
VLLLGGLFLAYRMGVFILAGIRLPIVLVGITVPLVGLLVGYCLATCLKLPVAQRRTVSIE
VGVQNSLLALAMLQLSLRRLQADYASQAPFIVALSGTSEMLALVIGHFIYSSLFPVP
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atggtgttaatgcaggacaagggcagctctcagcagtggcctggtctggggggcgagggt
ggtggcacaggtcccttaagcatgctcagagctgccctgctgctcatcagcctgccatgg
ggggcccaagggacagccagcaccagcctcagcactgctgggggtcacaccgtgccaccg
actgggggccgctacttgagcattggagatggctctgtgatggagtttgagtttcctgag
gacagtgagggcatcatcgtgatctccagccagtacccaggccaggccaacaggacggcg
cctggccccatgctcagggtcacctccctggacacagaggtgctgaccatcaagaacgtg
agtgctataacctggggaggcgggggtggctttgtggtgagcatccactcaggcctggct
gggctggccccactccacatccagctcgtggacgcccatgaggccccgcccacactgatt
gaggagcggagagacttctgcatcaaggtctcacctgctgaagacacgcctgccaccctc
agcgccgacctggcccacttctcggaaaacccaatcctctacctgctcctgcctcttatc
tttgtcaacaagtgttcgtttgggtgcaaagtggaactcgaggttctgaaggggctcatg
cagagcccccagcccatgctgctgggcctcctgggccagtttctggtcatgcccttgtac
gctttcctcatggccaaggtcttcatgctgcccaaggccctggctctgggcctcatcatc
acctgctcgtcgcctggcggcggggggagctacctcttcagcctccttcttggaggggac
gtcaccctggccatctccatgactttcctctctacggtggctgccactggcttcttgcct
ctgtcttcggccatctacagccgcctgctcagcatccatgagacgctccacgtgcccatc
tccaagatcctggggaccctgctgttcattgccatccccatagccgtgggcgtgctgatc
aagtccaagctccccaagttctcccagctgctgctgcaggtcgtcaagcccttcagcttt
gtgctcctcctgggcggcctcttcctggcctatcgcatgggggtcttcatcctggcaggc
atccggctacccatcgtactggtgggtatcacggtgcccctggttggcctgttggtgggc
tactgcctagccacgtgtctgaagctgccagtggcccagcggcggacggtcagcattgag
gtaggggtgcagaacagcctgctggccttggccatgctgcagctatccctccgccgcctt
caagctgactatgcctcccaggcccccttcattgtggcgctgagcggcacctccgagatg
ctggccttggtcattggccacttcatctacagcagcctgttcccagttccctga

DBGET integrated database retrieval system