KEGG   Homo sapiens (human): 828
Entry
828               CDS       T01001                                 
Symbol
CAPS, CAPS1
Name
(RefSeq) calcyphosine
  KO
K23909  calcyphosin
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:hsa04990]
    828 (CAPS)
Domain-containing proteins not elsewhere classified [BR:hsa04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   828 (CAPS)
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7 EF-hand_1 EF-hand_5 EF-hand_8 EF-hand_10
Other DBs
NCBI-GeneID: 828
NCBI-ProteinID: NP_004049
OMIM: 114212
HGNC: 1487
Ensembl: ENSG00000105519
UniProt: Q13938 A0A384NYV7 Q96ET4
Structure
Position
19:5914254..5916211
AA seq 189 aa
MDAVDATMEKLRAQCLSRGASGIQGLARFFRQLDRDGSRSLDADEFRQGLAKLGLVLDQA
EAEGVCRKWDRNGSGTLDLEEFLRALRPPMSQAREAVIAAAFAKLDRSGDGVVTVDDLRG
VYSGRAHPKVRSGEWTEDEVLRRFLDNFDSSEKDGQVTLAEFQDYYSGVSASMNTDEEFV
AMMTSAWQL
NT seq 570 nt   +upstreamnt  +downstreamnt
atggacgccgtggatgccaccatggagaaactccgggcacagtgcctgtcccgcggggcc
tcgggcatccagggcctggccaggtttttccgccaactagaccgggacgggagcagatcc
ctggacgctgatgagttccggcagggtctggccaaactcgggctggtgctggaccaggcg
gaggcagagggtgtgtgcaggaagtgggaccgcaatggcagcgggacgctggatctggag
gagttccttcgggcgctgcggccccccatgtcccaggcccgggaggctgtcatcgcagct
gcatttgccaagctggaccgcagtggggacggcgtcgtgacggtggacgacctccgcggg
gtgtacagtggccgtgcccaccccaaggtgcgcagtggggagtggaccgaggacgaggtg
ctgcgccgcttcctggacaacttcgactcctctgagaaggacgggcaggtcacactggcg
gaattccaggactactacagcggcgtgagtgcctccatgaacacggatgaggagttcgtg
gccatgatgaccagtgcctggcagctgtga

DBGET integrated database retrieval system