KEGG   Homo sapiens (human): 8284Help
Entry
8284              CDS       T01001                                 

Gene name
KDM5D, HY, HYA, JARID1D, SMCY
Definition
(RefSeq) lysine demethylase 5D
  KO
K11446  histone demethylase JARID1 [EC:1.14.11.-]
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8284 (KDM5D)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8284 (KDM5D)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.-  
     8284 (KDM5D)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8284 (KDM5D)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic Type
  Histone modification proteins
   Histone demethylases
    8284 (KDM5D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLU-1 JmjC ARID JmjN PHD zf-C5HC2
Motif
Other DBs
NCBI-GeneID: 8284
NCBI-ProteinID: NP_004644
OMIM: 426000
HGNC: 11115
Ensembl: ENSG00000012817
Vega: OTTHUMG00000036508
Pharos: Q9BY66(Tbio)
UniProt: Q9BY66 A0A384MR42
Structure
PDB: 

Position
Yq11.223
AA seq 1539 aa AA seqDB search
MEPGCDEFLPPPECPVFEPSWAEFQDPLGYIAKIRPIAEKSGICKIRPPADWQPPFAVEV
DNFRFTPRVQRLNELEAQTRVKLNYLDQIAKFWEIQGSSLKIPNVERKILDLYSLSKIVI
EEGGYEAICKDRRWARVAQRLHYPPGKNIGSLLRSHYERIIYPYEMFQSGANHVQCNTHP
FDNEVKDKEYKPHSIPLRQSVQPSKFSSYSRRAKRLQPDPEPTEEDIEKHPELKKLQIYG
PGPKMMGLGLMAKDKDKTVHKKVTCPPTVTVKDEQSGGGNVSSTLLKQHLSLEPCTKTTM
QLRKNHSSAQFIDSYICQVCSRGDEDDKLLFCDGCDDNYHIFCLLPPLPEIPRGIWRCPK
CILAECKQPPEAFGFEQATQEYSLQSFGEMADSFKSDYFNMPVHMVPTELVEKEFWRLVS
SIEEDVTVEYGADIHSKEFGSGFPVSNSKQNLSPEEKEYATSGWNLNVMPVLDQSVLCHI
NADISGMKVPWLYVGMVFSAFCWHIEDHWSYSINYLHWGEPKTWYGVPSLAAEHLEEVMK
MLTPELFDSQPDLLHQLVTLMNPNTLMSHGVPVVRTNQCAGEFVITFPRAYHSGFNQGYN
FAEAVNFCTADWLPAGRQCIEHYRRLRRYCVFSHEELICKMAAFPETLDLNLAVAVHKEM
FIMVQEERRLRKALLEKGVTEAEREAFELLPDDERQCIKCKTTCFLSALACYDCPDGLVC
LSHINDLCKCSSSRQYLRYRYTLDELPTMLHKLKIRAESFDTWANKVRVALEVEDGRKRS
FEELRALESEARERRFPNSELLQRLKNCLSEVEACIAQVLGLVSGQVARMDTPQLTLTEL
RVLLEQMGSLPCAMHQIGDVKDVLEQVEAYQAEAREALATLPSSPGLLRSLLERGQQLGV
EVPEAHQLQQQVEQAQWLDEVKQALAPSAHRGSLVIMQGLLVMGAKIASSPSVDKARAEL
QELLTIAERWEEKAHFCLEARQKHPPATLEAIIRETENIPVHLPNIQALKEALTKAQAWI
ADVDEIQNGDHYPCLDDLEGLVAVGRDLPVGLEELRQLELQVLTAHSWREKASKTFLKKN
SCYTLLEVLCPCADAGSDSTKRSRWMEKALGLYQCDTELLGLSAQDLRDPGSVIVAFKEG
EQKEKEGILQLRRTNSAKPSPLAPSLMASSPTSICVCGQVPAGVGVLQCDLCQDWFHGQC
VSVPHLLTSPKPSLTSSPLLAWWEWDTKFLCPLCMRSRRPRLETILALLVALQRLPVRLP
EGEALQCLTERAIGWQDRARKALASEDVTALLRQLAELRQQLQAKPRPEEASVYTSATAC
DPIREGSGNNISKVQGLLENGDSVTSPENMAPGKGSDLELLSSLLPQLTGPVLELPEAIR
APLEELMMEGDLLEVTLDENHSIWQLLQAGQPPDLDRIRTLLELEKFEHQGSRTRSRALE
RRRRRQKVDQGRNVENLVQQELQSKRARSSGIMSQVGREEEHYQEKADRENMFLTPSTDH
SPFLKGNQNSLQHKDSGSSAACPSLMPLLQLSYSDEQQL
NT seq 4620 nt NT seq  +upstreamnt  +downstreamnt
atggaaccggggtgtgacgagttcctgccgccaccggagtgcccggtttttgagcctagc
tgggctgaattccaagacccgcttggctacattgcgaaaataaggcccatagcagagaag
tctggcatctgcaaaatccgcccacccgcggattggcagcctccttttgcagtagaagtt
gacaatttcagatttactcctcgcgtccaaaggctaaatgaactggaggcccaaactaga
gtgaaattgaactatttggatcagattgcaaaattctgggaaattcaaggctcctcttta
aagattcccaatgtggagcggaagatcttggacctctacagccttagtaagattgtgatt
gaggaaggtggctatgaagccatctgcaaggatcgtcggtgggctcgagttgcccagcgt
ctccactacccaccaggcaaaaacattggctccctgctacgatcacattacgaacgcatt
atttacccctatgaaatgtttcagtctggagccaaccatgtgcaatgtaacacacacccg
tttgacaatgaggtaaaagataaggaatacaagccccacagcatcccccttagacagtct
gtgcagccttcaaagttcagcagctacagtcgacgggcaaaaaggctacagcctgatcca
gagcctacagaggaggacattgagaagcatccagagctaaagaagttacagatatatggg
ccaggtcccaaaatgatgggcttgggccttatggctaaggataaggataagactgtgcat
aagaaagtcacatgccccccaactgttacggtgaaggatgagcaaagtggaggtgggaac
gtgtcatcaacattgctcaagcagcacttgagcctagagccctgcactaagacaaccatg
caacttcgaaagaatcacagcagtgcccagtttattgactcatatatttgccaagtatgc
tcccgtggggatgaagatgataagcttcttttctgtgatggctgtgatgacaattaccac
atcttctgcttgttaccaccccttcctgaaatccccagaggcatctggaggtgcccaaaa
tgtatcttggcggagtgtaaacagcctcctgaagcttttggatttgaacaggctacccag
gagtacagtttgcagagttttggtgaaatggctgattccttcaagtccgactacttcaac
atgcctgtacatatggtgcctacagaacttgtagagaaggaattctggaggctggtgagc
agcattgaggaagacgtgacagttgaatatggagctgatattcattccaaagaatttggc
agtggctttcctgtcagcaatagcaaacaaaacttatctcctgaggagaaggagtatgcg
accagtggttggaacctgaatgtgatgccagtgctagatcagtctgttctctgtcacatc
aatgcagacatctcaggcatgaaggtgccctggctgtacgtgggcatggttttctcagca
ttttgttggcatattgaggatcactggagttactctattaactatctgcattggggtgag
ccgaagacctggtatggtgtaccctccctggcagcagagcatttggaggaggtgatgaag
atgctgacacctgagctgtttgatagccagcctgatctcctacaccagcttgtcactctc
atgaatcccaacactttgatgtcccatggtgtgccagttgtccgcacaaaccagtgtgca
ggggagtttgtcatcacttttcctcgtgcttaccacagtggttttaaccaaggctacaat
tttgctgaagctgtcaacttttgtactgctgactggctacctgctggacgccagtgcatt
gaacactaccgccggctccggcgctattgtgtcttctcccacgaggagctcatctgcaag
atggctgccttcccagagacgttggatctcaatctagcagtagctgtgcacaaggagatg
ttcattatggttcaggaggagcgacgtctacgaaaggcccttttggagaagggcgtcacg
gaggctgagcgagaggcttttgagctgctcccagatgatgaacgccagtgcatcaagtgc
aagaccacgtgcttcttgtcagccctggcctgctacgactgcccagatggccttgtatgc
ctttcccacatcaatgacctctgcaagtgctctagtagccgacagtacctccggtatcgg
tacaccttggatgagctccccaccatgctgcataaactgaagattcgggctgagtctttt
gacacctgggccaacaaagtgcgagtggccttggaggtggaggatggccgtaaacgcagc
tttgaagagctaagggcactggagtctgaggctcgtgagaggaggtttcctaatagtgag
ctgcttcagcgactgaagaactgcctgagtgaggtggaggcttgtattgctcaagtcctg
gggctggtcagtggtcaggtggccaggatggacactccacagctgaccttgactgaactc
cgggtccttcttgagcagatgggcagcctgccctgtgccatgcatcagattggggatgtc
aaggatgtcctggaacaggtggaggcctatcaagctgaggctcgtgaggctctggccaca
ctgccctctagtccagggctattgcggtccctgttggagagggggcagcagctgggtgta
gaggtgcctgaagcccatcagcttcagcagcaggtggagcaggcgcaatggctagatgaa
gtgaagcaggccctggccccttctgctcacaggggctctctggtcatcatgcaggggctt
ttggttatgggtgccaagatagcctccagcccttctgtggacaaggcccgggctgagctg
caagaactactgaccattgcagagcgctgggaagaaaaggctcatttctgcctggaggcc
aggcagaagcatccaccagccacattggaagccataattcgtgagacagaaaacatccct
gttcacctgcctaacatccaggctctcaaagaagctctgactaaggcacaagcttggatt
gctgatgtggatgagatccaaaatggtgaccactacccctgtctagatgacttggagggc
ctggtggctgtgggccgggacctgcctgtggggctggaagagctgagacagctagagctg
caggtattgacagcacattcctggagagagaaggcctccaagacctttctcaagaagaat
tcttgctacacactgcttgaggtgctttgcccgtgtgcagacgctggctcagacagcacc
aagcgtagccggtggatggagaaggcgctggggttgtaccagtgtgacacagagctgctg
gggctgtctgcacaggacctcagagacccaggctctgtgattgtggccttcaaggaaggg
gaacagaaggagaaggagggtatcctgcagctgcgtcgcaccaactcagccaagcccagt
ccactggcaccatccctcatggcctcttctccgacttctatctgtgtgtgtgggcaggtg
ccagctggggtgggagttctgcagtgtgacctgtgtcaggactggttccatgggcagtgt
gtgtcagtgccccatctcctcacctctccaaagcccagtctcacttcatctccactgcta
gcctggtgggaatgggacacaaaattcctgtgtccactgtgtatgcgctcacgacggcca
cgcctagagacaatcctagccttgctggttgccctgcagaggctgcccgtgcggctgcct
gagggtgaggcccttcagtgtctcacagagagggccattggctggcaagaccgtgccaga
aaggctctggcctctgaagatgtgactgctctgttgcgacagctggctgagcttcgccaa
cagctacaggccaaacccagaccagaggaggcctcagtctacacttcagccactgcctgt
gaccctatcagagaaggcagtggcaacaatatttctaaggtccaagggctgctggagaat
ggagacagtgtgaccagtcctgagaacatggctccaggaaagggctctgacctggagcta
ctgtcctcactgttgccgcagttgactggccctgtgttggagctgcctgaggcaatccgg
gctcccctggaggagctcatgatggaaggggacctgcttgaggtgaccctggatgagaac
cacagcatctggcagctgctgcaggctggacagcctccagacctggacagaattcgcaca
cttctggagctggaaaaatttgaacatcaagggagtcggacaaggagccgggctctggag
aggcgacggcggcggcagaaggtggatcagggtagaaacgttgagaatcttgttcaacag
gagcttcagtcaaaaagggctcggagctcagggattatgtctcaggtgggccgagaagaa
gaacattatcaggagaaagcagaccgtgaaaatatgttcctgacaccttccacagaccac
agccctttcttgaaaggaaaccaaaatagcttacaacacaaggattcaggctcttcagct
gcttgtccttctttaatgcctttgctacaactctcctactctgatgagcaacagttgtga

DBGET integrated database retrieval system