KEGG   Homo sapiens (human): 8288
Entry
8288              CDS       T01001                                 

Gene name
EPX, EPO, EPP, EPX-PEN, EPXD
Definition
(RefSeq) eosinophil peroxidase
  KO
K10788  eosinophil peroxidase [EC:1.11.1.7]
Organism
hsa  Homo sapiens (human)
Pathway
hsa05310  Asthma
Disease
H01094  Eosinophil peroxidase deficiency
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09163 Immune disease
   05310 Asthma
    8288 (EPX)
Enzymes [BR:hsa01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.7  peroxidase
     8288 (EPX)
SSDB
Motif
Pfam: An_peroxidase
Other DBs
NCBI-GeneID: 8288
NCBI-ProteinID: NP_000493
OMIM: 131399
HGNC: 3423
Ensembl: ENSG00000121053
Vega: OTTHUMG00000178802
Pharos: P11678(Tbio)
UniProt: P11678
Position
17q22
AA seq 715 aa
MHLLPALAGVLATLVLAQPCEGTDPASPGAVETSVLRDCIAEAKLLVDAAYNWTQKSIKQ
RLRSGSASPMDLLSYFKQPVAATRTVVRAADYMHVALGLLEEKLQPQRSGPFNVTDVLTE
PQLRLLSQASGCALRDQAERCSDKYRTITGRCNNKRRPLLGASNQALARWLPAEYEDGLS
LPFGWTPSRRRNGFLLPLVRAVSNQIVRFPNERLTSDRGRALMFMQWGQFIDHDLDFSPE
SPARVAFTAGVDCERTCAQLPPCFPIKIPPNDPRIKNQRDCIPFFRSAPSCPQNKNRVRN
QINALTSFVDASMVYGSEVSLSLRLRNRTNYLGLLAINQRFQDNGRALLPFDNLHDDPCL
LTNRSARIPCFLAGDTRSTETPKLAAMHTLFMREHNRLATELRRLNPRWNGDKLYNEARK
IMGAMVQIITYRDFLPLVLGKARARRTLGHYRGYCSNVDPRVANVFTLAFRFGHTMLQPF
MFRLDSQYRASAPNSHVPLSSAFFASWRIVYEGGIDPILRGLMATPAKLNRQDAMLVDEL
RDRLFRQVRRIGLDLAALNMQRSRDHGLPGYNAWRRFCGLSQPRNLAQLSRVLKNQDLAR
KFLNLYGTPDNIDIWIGAIAEPLLPGARVGPLLACLFENQFRRARDGDRFWWQKRGVFTK
RQRKALSRISLSRIICDNTGITTVSRDIFRANIYPRGFVNCSRIPRLNLSAWRGT
NT seq 2148 nt   +upstreamnt  +downstreamnt
atgcatctgctcccagccctggcaggggtcctggccacactcgtcctcgcccagccctgt
gagggcactgacccagcctcccctggggcagtggagacctcggtcctgcgagactgcata
gcagaggccaagttgctggtggatgctgcctacaattggacccagaagagcatcaagcag
cggcttcgcagcggttcagccagccccatggacctcctgtcctacttcaaacaaccggta
gcagccaccaggacagttgttcgggccgcagattatatgcatgtggctttggggctgctt
gaagagaagttacaaccccagcggtccggacccttcaatgtcactgatgtgctaacagaa
ccacagctgcggctgctgtcccaggccagtggctgtgctctccgggaccaggccgagcgc
tgcagcgacaagtaccgcaccatcactggacggtgcaacaacaagaggagacccttgcta
ggggcctccaaccaggctctggctcgctggctgcccgccgagtatgaggatgggctgtcg
ctccccttcggctggacccccagcaggaggcgcaatggcttccttctccctcttgtccgg
gctgtctccaaccagattgtgcgcttccccaatgagagactgacctccgaccgtggccga
gccctcatgttcatgcagtggggccagttcattgaccatgacctggacttctccccggag
tccccggccagagtggccttcactgcaggcgttgactgtgagaggacctgcgcccagctg
cccccctgctttcccatcaagatcccacccaatgacccccgcatcaagaaccagcgtgac
tgcatccctttcttccgctcggcaccctcatgcccccaaaacaagaacagagtccgcaac
cagatcaacgcgctcacctcctttgtggacgccagcatggtgtatggcagtgaggtctcc
ctctcgctgcggctccgcaaccggaccaactacctggggctgctggccatcaaccagcgc
tttcaagacaacggccgggccctgctgcccttcgacaacctgcacgatgacccctgtctc
ctcaccaaccgctcggcgcgcatcccctgcttcctggcaggtgacacccgatcaacggaa
acccccaaactggcagccatgcacaccctctttatgcgagagcacaaccggctggccacc
gagctgagacgcctgaatccccggtggaatggagacaaactgtacaatgaggctcggaag
atcatgggggccatggtccagatcatcacctaccgagactttctgcccctggttctgggc
aaggcccgggccaggagaaccctggggcactacagggggtactgctccaatgtggaccca
cgggtggccaatgtcttcaccctggccttccgctttggccacacaatgctccagcccttc
atgttccgcttggacagtcagtaccgggcctccgcacccaactcgcatgtcccacttagc
tctgccttctttgccagctggcggatcgtgtatgaagggggcatcgaccccatcctccgg
ggcctcatggccacccctgccaagctgaaccgtcaggatgccatgttagtggatgagctc
cgggaccggctgtttcggcaagtgaggaggattgggctggacctggcagctctcaacatg
caacgaagccgggaccacggccttccagggtacaatgcttggaggcgcttctgtgggctc
tcccagccccggaatttggcacagcttagccgggtgctgaaaaaccaggacttggcaagg
aagttcctgaatttgtatggaacacctgacaacattgacatctggattggggccatcgct
gagcctcttttgccgggggctcgagtggggcctcttctggcttgtctgttcgagaaccag
ttcagaagagcccgagacggagacaggttctggtggcagaaacgaggtgttttcaccaaa
agacagcgcaaggccctgagcagaatttccttgtctcgaattatatgtgacaataccggt
atcaccacggtttcaagggacatcttcagagccaacatctaccctcggggctttgtgaac
tgcagccgtatccccaggttgaacctatcagcctggcgagggacatga

DBGET integrated database retrieval system