KEGG   Homo sapiens (human): 829Help
Entry
829               CDS       T01001                                 

Gene name
CAPZA1, CAPPA1, CAPZ, CAZ1
Definition
(RefSeq) capping actin protein of muscle Z-line subunit alpha 1
  KO
K10364  capping protein (actin filament) muscle Z-line, alpha
Organism
hsa  Homo sapiens (human)
Pathway
hsa04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    829 (CAPZA1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    829 (CAPZA1)
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:hsa04812]
    829 (CAPZA1)
   04147 Exosome [BR:hsa04147]
    829 (CAPZA1)
Membrane trafficking [BR:hsa04131]
 Endosome - Lysosome transport
  Others
   WASH complex
    829 (CAPZA1)
Cytoskeleton proteins [BR:hsa04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Capping proteins
     829 (CAPZA1)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   829 (CAPZA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: F-actin_cap_A CCP_MauG
Motif
Other DBs
NCBI-GeneID: 829
NCBI-ProteinID: NP_006126
OMIM: 601580
HGNC: 1488
Ensembl: ENSG00000116489
Vega: OTTHUMG00000011769
Pharos: P52907(Tbio)
UniProt: P52907 A0A024R0E5
Position
1p13.2
AA seq 286 aa AA seqDB search
MADFDDRVSDEEKVRIAAKFITHAPPGEFNEVFNDVRLLLNNDNLLREGAAHAFAQYNMD
QFTPVKIEGYEDQVLITEHGDLGNSRFLDPRNKISFKFDHLRKEASDPQPEEADGGLKSW
RESCDSALRAYVKDHYSNGFCTVYAKTIDGQQTIIACIESHQFQPKNFWNGRWRSEWKFT
ITPPTAQVVGVLKIQVHYYEDGNVQLVSHKDVQDSLTVSNEAQTAKEFIKIIENAENEYQ
TAISENYQTMSDTTFKALRRQLPVTRTKIDWNKILSYKIGKEMQNA
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atggccgacttcgatgatcgtgtgtcggatgaggagaaggtacgcatagctgctaaattc
atcactcatgcacccccaggggaatttaatgaagtattcaatgacgttcggctactactt
aataatgacaatctcctcagggaaggggcagcacatgcatttgcccagtataacatggat
cagttcacgcctgtgaagatagaaggatatgaagatcaggtcttaattacagagcacggt
gacctgggtaatagcagatttttagatccaagaaacaaaatttcctttaaatttgaccac
ttacggaaagaagcaagtgacccccagccagaagaagcagatggaggtctgaagtcttgg
agagaatcctgtgacagtgctttaagagcctatgtgaaagaccattattccaacggcttc
tgtactgtttatgctaaaactatcgatgggcaacagactattattgcatgtattgaaagc
caccagtttcagcctaaaaacttctggaatggtcgttggagatcagagtggaagttcacc
atcacaccacctacagcccaggtggttggcgtgcttaagattcaggttcactattatgaa
gatggcaatgttcagttggttagtcataaagatgtacaggattcactaactgtttcgaat
gaagcccaaactgccaaggagtttattaaaatcatagagaatgcagaaaatgagtatcag
acagcaattagtgaaaactatcaaacaatgtcagataccacattcaaggccttgcgccgg
cagcttccagttacccgcaccaaaatcgactggaacaagatactcagctacaagattggc
aaagaaatgcagaatgcttaa

DBGET integrated database retrieval system