KEGG   Homo sapiens (human): 8290
Entry
8290              CDS       T01001                                 

Gene name
H3-4, H3.4, H3/g, H3FT, H3t, HIST3H3
Definition
(RefSeq) H3.4 histone
  KO
K11253  histone H3
Organism
hsa  Homo sapiens (human)
Pathway
hsa05034  Alcoholism
hsa05131  Shigellosis
hsa05202  Transcriptional misregulation in cancer
hsa05322  Systemic lupus erythematosus
Network
nt06240  Transcription
  Element
N00125  IGH-MMSET fusion to transcriptional activation
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    8290 (H3-4)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8290 (H3-4)
  09165 Substance dependence
   05034 Alcoholism
    8290 (H3-4)
  09171 Infectious disease: bacterial
   05131 Shigellosis
    8290 (H3-4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8290 (H3-4)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8290 (H3-4)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8290 (H3-4)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8290 (H3-4)
SSDB
Motif
Pfam: Histone CBFD_NFYB_HMF PAF CENP-S CENP-T_C
Other DBs
NCBI-GeneID: 8290
NCBI-ProteinID: NP_003484
OMIM: 602820
HGNC: 4778
Ensembl: ENSG00000168148
Vega: OTTHUMG00000040044
Pharos: Q16695(Tbio)
UniProt: Q16695
Structure
PDB: 

Position
1q42.13
AA seq 136 aa
MARTKQTARKSTGGKAPRKQLATKVARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLMREIAQDFKTDLRFQSSAVMALQEACESYLVGLFEDTNLCVIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt   +upstreamnt  +downstreamnt
atggcccgaaccaagcagactgcgcgcaagtcaacgggtggcaaggcgccgcgcaagcag
ctggccaccaaggtggctcgcaagagcgcacctgccactggcggcgtgaagaagccgcac
cgctaccggcccggcacggtggcgcttcgcgagatccgccgctaccagaagtccactgag
ctgctaatccgcaagttgcccttccagcggctgatgcgcgagatcgctcaggactttaag
accgacctgcgcttccagagctcggccgtgatggcgctgcaggaggcgtgcgagtcttac
ctggtggggctgtttgaggacaccaacctgtgtgtcatccatgccaaacgggtcaccatc
atgcctaaggacatccagctggcacgccgtatccgcggggagcgggcctag

DBGET integrated database retrieval system