KEGG   Homo sapiens (human): 8301Help
Entry
8301              CDS       T01001                                 

Gene name
PICALM, CALM, CLTH, LAP
Definition
(RefSeq) phosphatidylinositol binding clathrin assembly protein
  KO
K20044  phosphatidylinositol-binding clathrin assembly protein
Organism
hsa  Homo sapiens (human)
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:hsa04131]
    8301 (PICALM)
Membrane trafficking [BR:hsa04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    8301 (PICALM)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANTH ENTH
Motif
Other DBs
NCBI-GeneID: 8301
NCBI-ProteinID: NP_009097
OMIM: 603025
HGNC: 15514
Ensembl: ENSG00000073921
Vega: OTTHUMG00000166981
Pharos: Q13492(Tbio)
UniProt: Q13492 A0A024R5P1
Position
11q14.2
AA seq 652 aa AA seqDB search
MSGQSLTDRITAAQHSVTGSAVSKTVCKATTHEIMGPKKKHLDYLIQCTNEMNVNIPQLA
DSLFERTTNSSWVVVFKSLITTHHLMVYGNERFIQYLASRNTLFNLSNFLDKSGLQGYDM
STFIRRYSRYLNEKAVSYRQVAFDFTKVKRGADGVMRTMNTEKLLKTVPIIQNQMDALLD
FNVNSNELTNGVINAAFMLLFKDAIRLFAAYNEGIINLLEKYFDMKKNQCKEGLDIYKKF
LTRMTRISEFLKVAEQVGIDRGDIPDLSQAPSSLLDALEQHLASLEGKKIKDSTAASRAT
TLSNAVSSLASTGLSLTKVDEREKQAALEEEQARLKALKEQRLKELAKKPHTSLTTAASP
VSTSAGGIMTAPAIDIFSTPSSSNSTSKLPNDLLDLQQPTFHPSVHPMSTASQVASTWGD
PFSATVDAVDDAIPSLNPFLTKSSGDVHLSISSDVSTFTTRTPTHEMFVGFTPSPVAQPH
PSAGLNVDFESVFGNKSTNVIVDSGGFDELGGLLKPTVASQNQNLPVAKLPPSKLVSDDL
DSSLANLVGNLGIGNGTTKNDVNWSQPGEKKLTGGSNWQPKVAPTTAWNAATMAPPVMAY
PATTPTGMIGYGIPPQMGSVPVMTQPTLIYSQPVMRPPNPFGPVSGAQIQFM
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgtccggccagagcctgacggaccgaatcactgccgcccagcacagtgtcaccggctct
gccgtatccaagacagtatgcaaggccacgacccacgagatcatggggcccaagaaaaag
cacctggactacttaattcagtgcacaaatgagatgaatgtgaacatcccacagttggca
gacagtttatttgaaagaactactaatagtagttgggtggtggtcttcaaatctctcatt
acaactcatcatttgatggtgtatggaaatgagcgttttattcagtatttggcttcaaga
aacacgttgtttaacttaagcaattttttggataaaagtggattgcaaggatatgacatg
tctacatttattaggcggtatagtagatatttaaatgagaaagcagtttcatacagacaa
gttgcatttgatttcacaaaagtgaagagaggggctgatggagttatgagaacaatgaac
acagaaaaactcctaaaaactgtaccaattattcagaatcagatggatgcacttcttgat
tttaatgttaatagcaatgaacttacaaatggggtaataaatgctgccttcatgctcctg
ttcaaagatgccattagactgtttgcagcatacaatgaaggaattattaatttgttggaa
aaatattttgatatgaaaaagaaccaatgcaaagaaggtcttgacatctataagaagttc
ctaactaggatgacaagaatctcagagttcctcaaagttgcagagcaagttggaattgac
agaggtgatataccagacctttcacaggcccctagcagtcttcttgatgctttggaacaa
catttagcttccttggaaggaaagaaaatcaaagattctacagctgcaagcagggcaact
acactttccaatgcagtgtcttccctggcaagcactggtctatctctgaccaaagtggat
gaaagggaaaagcaggcagcattagaggaagaacaggcacgtttgaaagctttaaaggaa
cagcgcctaaaagaacttgcaaagaaacctcatacctctttaacaactgcagcctctcct
gtatccacctcagcaggagggataatgactgcaccagccattgacatattttctacccct
agttcttctaacagcacatcaaagctgcccaatgatctgcttgatttgcagcagccaact
tttcacccatctgtacatcctatgtcaactgcttctcaggtagcaagtacatggggagat
cctttctctgctactgtagatgctgttgatgatgccattccaagcttaaatcctttcctc
acaaaaagtagtggtgatgttcacctttccatttcttcagatgtatctacttttactact
aggacacctactcatgaaatgtttgttggattcactccttctccagttgcacagccacac
ccttcagctggccttaatgttgactttgaatctgtgtttggaaataaatctacaaatgtt
attgtagattctgggggctttgatgaactaggtggacttctcaaaccaacagtggcctct
cagaaccagaaccttcctgttgccaaactcccacctagcaagttagtatctgatgacttg
gattcatctttagccaaccttgtgggcaatcttggcatcggaaatggaaccactaagaat
gatgtaaattggagtcaaccaggtgaaaagaagttaactgggggatctaactggcaacca
aaggttgcaccaacaaccgcttggaatgctgcaacaatggcaccccctgtaatggcctat
cctgctactacaccaacaggcatgataggatatggaattcctccacaaatgggaagtgtt
cctgtaatgacgcaaccaaccttaatatacagccagcctgtcatgagacctccaaacccc
tttggccctgtatcaggagcacagatacagtttatgtaa

DBGET integrated database retrieval system