KEGG   Homo sapiens (human): 831
Entry
831               CDS       T01001                                 

Symbol
CAST, BS-17, PLACK
Name
(RefSeq) calpastatin
  KO
K04281  calpastatin
Organism
hsa  Homo sapiens (human)
Pathway
hsa05131  Shigellosis
Disease
H00737  Peeling skin syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05131 Shigellosis
    831 (CAST)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:hsa01002]
    831 (CAST)
Peptidases and inhibitors [BR:hsa01002]
 Peptidase inhibitors
  Family I27: calpastatin family
   831 (CAST)
SSDB
Motif
Pfam: Calpain_inhib
Other DBs
NCBI-GeneID: 831
NCBI-ProteinID: NP_001035908
OMIM: 114090
HGNC: 1515
Ensembl: ENSG00000153113
Vega: OTTHUMG00000128413
Pharos: P20810(Tbio)
UniProt: P20810
Position
5q15
AA seq 708 aa
MNPTETKAIPVSQQMEGPHLPNKKKHKKQAVKTEPEKKSQSTKLSVVHEKKSQEGKPKEH
TEPKSLPKQASDTGSNDAHNKKAVSRSAEQQPSEKSTEPKTKPQDMISAGGESVAGITAI
SGKPGDKKKEKKSLTPAVPVESKPDKPSGKSGMDAALDDLIDTLGGPEETEEENTTYTGP
EVSDPMSSTYIEELGKREVTIPPKYRELLAKKEGITGPPADSSKPIGPDDAIDALSSDFT
CGSPTAAGKKTEKEESTEVLKAQSAGTVRSAAPPQEKKRKVEKDTMSDQALEALSASLGT
RQAEPELDLRSIKEVDEAKAKEEKLEKCGEDDETIPSEYRLKPATDKDGKPLLPEPEEKP
KPRSESELIDELSEDFDRSECKEKPSKPTEKTEESKAAAPAPVSEAVCRTSMCSIQSAPP
EPATLKGTVPDDAVEALADSLGKKEADPEDGKPVMDKVKEKAKEEDREKLGEKEETIPPD
YRLEEVKDKDGKPLLPKESKEQLPPMSEDFLLDALSEDFSGPQNASSLKFEDAKLAAAIS
EVVSQTPASTTQAGAPPRDTSQSDKDLDDALDKLSDSLGQRQPDPDENKPMEDKVKEKAK
AEHRDKLGERDDTIPPEYRHLLDDNGQDKPVKPPTKKSEDSKKPADDQDPIDALSGDLDS
CPSTTETSQNTAKDKCKKAASSSKAPKNGGKAKDSAKTTEETSKPKDD
NT seq 2127 nt   +upstreamnt  +downstreamnt
atgaatcccacagaaaccaaggccattccagtcagccaacagatggaaggaccacatctt
cctaacaagaaaaaacacaaaaaacaggctgtaaaaacagaacctgagaagaagtcacag
tcaaccaagctgtctgtggttcatgagaaaaaatcccaagaaggaaagccaaaagaacac
acagagccaaaaagcctacccaagcaggcatcagatacaggaagtaacgatgctcacaat
aaaaaagcagtttccagatcagctgaacagcagccatcagagaaatcaacagaaccaaag
actaaaccacaagacatgatttctgctggtggagagagtgttgctggtatcactgcaata
tctggcaagccgggtgacaagaaaaaagaaaagaaatcattaaccccagctgtgccagtt
gaatctaaaccggataaaccatcgggaaagtcaggcatggatgctgctttggatgactta
atagatactttaggaggacctgaagaaactgaagaagaaaatacaacgtatactggacca
gaagtttcagatccaatgagttccacctacatagaggaattgggtaaaagagaagtcaca
attcctccaaaatatagggaactattggctaaaaaggaagggatcacagggcctcctgca
gactcttcgaaacccatagggccagatgatgctatagacgccttgtcatctgacttcacc
tgtgggtcgcctacagctgctggaaagaaaactgaaaaagaggaatctacagaagtttta
aaagctcagtcagcagggacagtcagaagtgctgctccaccccaagagaagaaaagaaag
gtggagaaggatacaatgagtgatcaagcactcgaggctctgtcggcttcactgggcacc
cggcaagcagaacctgagctcgacctccgctcaattaaggaagtcgatgaggcaaaagct
aaagaagaaaaactagagaagtgtggtgaggatgatgaaacaatcccatctgagtacaga
ttaaaaccagccacggataaagatggaaaaccactattgccagagcctgaagaaaaaccc
aagcctcggagtgaatcagaactcattgatgaactttcagaagattttgaccggtctgaa
tgtaaagagaaaccatctaagccaactgaaaagacagaagaatctaaggccgctgctcca
gctcctgtgtcggaggctgtgtgtcggacctccatgtgtagtatacagtcagcaccccct
gagccggctaccttgaagggcacagtgccagatgatgctgtagaagccttggctgatagc
ctggggaaaaaggaagcagatccagaagatggaaaacctgtgatggataaagtcaaggag
aaggccaaagaagaagaccgtgaaaagcttggtgaaaaagaagaaacaattcctcctgat
tatagattagaagaggtcaaggataaagatggaaagccactcctgccaaaagagtctaag
gaacagcttccacccatgagtgaagacttccttctggatgctttgtctgaggacttctct
ggtccacaaaatgcttcatctcttaaatttgaagatgctaaacttgctgctgccatctct
gaagtggtttcccaaaccccagcttcaacgacccaagctggagccccaccccgtgatacc
tcgcagagtgacaaagacctcgatgatgccttggataaactctctgacagtctaggacaa
aggcagcctgacccagatgagaacaaaccaatggaagataaagtaaaggaaaaagctaaa
gctgaacatagagacaagcttggagaaagagatgacactatcccacctgaatacagacat
ctcctggatgataatggacaggacaaaccagtgaagccacctacaaagaaatcagaggat
tcaaagaaacctgcagatgaccaagaccccattgatgctctctcaggagatctggacagc
tgtccctccactacagaaacctcacagaacacagcaaaggataagtgcaagaaggctgct
tccagctccaaagcacctaagaatggaggtaaagcgaaggattcagcaaagacaacagag
gaaacttccaagccaaaagatgactaa

DBGET integrated database retrieval system