KEGG   Homo sapiens (human): 8312Help
Entry
8312              CDS       T01001                                 

Gene name
AXIN1, AXIN, PPP1R49
Definition
(RefSeq) axin 1
  KO
K02157  axin 1
Organism
hsa  Homo sapiens (human)
Pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05210  Colorectal cancer
hsa05213  Endometrial cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Network
nt06115  WNT signaling (virus)
nt06164  Kaposi sarcoma-associated herpesvirus (KSHV)
nt06215  WNT signaling
nt06260  Colorectal cancer
nt06261  Gastric cancer
nt06263  Hepatocellular carcinoma
nt06270  Breast cancer
nt06271  Endometrial cancer
nt06274  Thyroid cancer
  Element
N00056  Wnt signaling pathway
N00057  Mutation-inactivated APC to Wnt signaling pathway
N00058  Mutation-activated CTNNB1 to Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
N00242  Mutation-inactivated AXIN to Wnt signaling pathway
Disease
H00048  Hepatocellular carcinoma
H00934  Caudal duplication anomaly
H01667  Medulloblastoma
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8312 (AXIN1)
   04390 Hippo signaling pathway
    8312 (AXIN1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8312 (AXIN1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    8312 (AXIN1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    8312 (AXIN1)
   05225 Hepatocellular carcinoma
    8312 (AXIN1)
   05226 Gastric cancer
    8312 (AXIN1)
   05217 Basal cell carcinoma
    8312 (AXIN1)
   05213 Endometrial cancer
    8312 (AXIN1)
   05224 Breast cancer
    8312 (AXIN1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    8312 (AXIN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    8312 (AXIN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:hsa01009]
    8312 (AXIN1)
Protein phosphatases and associated proteins [BR:hsa01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     8312 (AXIN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind
Motif
Other DBs
NCBI-GeneID: 8312
NCBI-ProteinID: NP_003493
OMIM: 603816
HGNC: 903
Ensembl: ENSG00000103126
Vega: OTTHUMG00000064930
Pharos: O15169(Tbio)
UniProt: O15169 A0A0S2Z4R0
Structure
PDB: 

Position
16p13.3
AA seq 862 aa AA seqDB search
MNIQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDPRPASYSFCSGKGVGIKGETSTAT
PRRSDLDLGYEPEGSASPTPPYLKWAESLHSLLDDQDGISLFRTFLKQEGCADLLDFWFA
CTGFRKLEPCDSNEEKRLKLARAIYRKYILDNNGIVSRQTKPATKSFIKGCIMKQLIDPA
MFDQAQTEIQATMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGISGYLPT
LNEDEEWKCDQDMDEDDGRDAAPPGRLPQKLLLETAAPRVSSSRRYSEGREFRYGSWREP
VNPYYVNAGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRREMQESV
QVNGRVPLPHIPRTYRVPKEVRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKRVRMEE
EGEDGDPSSGPPGPCHKLPPAPAWHHFPPRCVDMGCAGLRDAHEENPESILDEHVQRVLR
TPGRQSPGPGHRSPDSGHVAKMPVALGGAASGHGKHVPKSGAKLDAAGLHHHRHVHHHVH
HSTARPKEQVEAEATRRAQSSFAWGLEPHSHGARSRGYSESVGAAPNASDGLAHSGKVGV
ACKRNAKKAESGKSASTEVPGASEDAEKNQKIMQWIIEGEKEISRHRRTGHGSSGTRKPQ
PHENSRPLSLEHPWAGPQLRTSVQPSHLFIQDPTMPPHPAPNPLTQLEEARRRLEEEEKR
ASRAPSKQRYVQEVMRRGRACVRPACAPVLHVVPAVSDMELSETETRSQRKVGGGSAQPC
DSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCGVVFEEV
REDEAVLPVFEEKIIGKVEKVD
NT seq 2589 nt NT seq  +upstreamnt  +downstreamnt
atgaatatccaagagcagggtttccccttggacctcggagcaagtttcaccgaagatgct
ccccgacccccagtgcctggtgaggagggagaactggtgtccacagacccgaggcccgcc
agctacagtttctgctccgggaaaggtgttggcattaaaggtgagacttcgacggccact
ccgaggcgctcggatctggacctggggtatgagcctgagggcagtgcctcccccacccca
ccatacttgaagtgggctgagtcactgcattccctgctggatgaccaagatgggataagc
ctgttcaggactttcctgaagcaggagggctgtgccgacttgctggacttctggtttgcc
tgcactggcttcaggaagctggagccctgtgactcgaacgaggagaagaggctgaagctg
gcgagagccatctaccgaaagtacattcttgataacaatggcatcgtgtcccggcagacc
aagccagccaccaagagcttcataaagggctgcatcatgaagcagctgatcgatcctgcc
atgtttgaccaggcccagaccgaaatccaggccactatggaggaaaacacctatccctcc
ttccttaagtctgatatttatttggaatatacgaggacaggctcggagagccccaaagtc
tgtagtgaccagagctctgggtcagggacagggaagggcatatctggatacctgccgacc
ttaaatgaagatgaggaatggaagtgtgaccaggacatggatgaggacgatggcagagac
gctgctccccccggaagactccctcagaagctgctcctggagacagctgccccgagggtc
tcctccagtagacggtacagcgaaggcagagagttcaggtatggatcctggcgggagcca
gtcaacccctattatgtcaatgccggctatgccctggccccagccaccagtgccaacgac
agcgagcagcagagcctgtccagcgatgcagacaccctgtccctcacggacagcagcgtg
gatgggatccccccatacaggatccgtaagcagcaccgcagggagatgcaggagagcgtg
caggtcaatgggcgggtgcccctacctcacattccccgcacgtaccgggtgccgaaggag
gtccgcgtggagcctcagaagttcgcggaggagctcatccaccgcctggaggctgtgcag
cgcacgcgggaggccgaggagaagctggaggagcggctgaagcgcgtgcgcatggaggag
gaaggtgaggacggcgatccatcgtcagggcccccagggccgtgtcacaagctgcctccc
gcccccgcttggcaccacttcccgccccgctgtgtggacatgggctgtgccgggctccgg
gatgcacacgaggagaaccctgagagcatcctggacgagcacgtacagcgtgtgctgagg
acacctggccgccagtcgcctgggcctggccatcgctccccggacagtgggcacgtggcc
aagatgccagtggcactggggggtgccgcctcggggcacgggaagcacgtacccaagtca
ggggcgaagctggacgcggccggcctgcaccaccaccgacacgtccaccaccacgtccac
cacagcacagcccggcccaaggagcaggtggaggccgaggccacccgcagggcccagagc
agcttcgcctggggcctggaaccacacagccatggggcaaggtcccgaggctactcagag
agtgttggcgctgcccccaacgccagtgatggcctcgcccacagtgggaaggtgggcgtg
gcgtgcaaaagaaatgccaagaaggctgagtcggggaagagcgccagcaccgaggtgcca
ggtgcctcggaggatgcggagaagaaccagaaaatcatgcagtggatcattgagggggaa
aaggagatcagcaggcaccgcaggaccggccacgggtcttcggggacgaggaagccacag
ccccatgagaactccagacccttgtcccttgagcacccctgggccggccctcagctccgg
acctccgtgcagccctcccacctcttcatccaagaccccaccatgccaccccacccagct
cccaaccccctaacccagctggaggaggcgcgccgacgtctggaggaggaagaaaagaga
gccagccgagcaccctccaagcagaggtatgtgcaggaggttatgcggcggggacgcgcc
tgcgtcaggccagcgtgcgcgccggtgctgcacgtggtaccagccgtgtcggacatggag
ctctccgagacagagacaagatcgcagaggaaggtgggcggcgggagtgcccagccgtgt
gacagcatcgttgtggcgtactacttctgcggggaacccatcccctaccgcaccctggtg
aggggccgcgctgtcaccctgggccagttcaaggagctgctgaccaaaaagggcagctac
agatactacttcaagaaagtgagcgacgagtttgactgtggggtggtgtttgaggaggtt
cgagaggacgaggccgtcctgcccgtctttgaggagaagatcatcggcaaagtggagaag
gtggactga

DBGET integrated database retrieval system