KEGG   Homo sapiens (human): 8317Help
Entry
8317              CDS       T01001                                 

Gene name
CDC7, CDC7L1, HsCDC7, Hsk1, huCDC7
Definition
(RefSeq) cell division cycle 7
  KO
K02214  cell division control protein 7 [EC:2.7.11.1]
Organism
hsa  Homo sapiens (human)
Pathway
hsa04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    8317 (CDC7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:hsa01001]
    8317 (CDC7)
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:hsa03032]
    8317 (CDC7)
Enzymes [BR:hsa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     8317 (CDC7)
Protein kinases [BR:hsa01001]
 Serine/threonine kinases: Other
  CDC7 family
   8317 (CDC7)
DNA replication proteins [BR:hsa03032]
 Eukaryotic type
  DNA Replication Initiation Factors
   DDK (Dbf-4 dependent kinase)
    8317 (CDC7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr APH
Motif
Other DBs
NCBI-GeneID: 8317
NCBI-ProteinID: NP_001127891
OMIM: 603311
HGNC: 1745
Ensembl: ENSG00000097046
Vega: OTTHUMG00000047810
Pharos: O00311(Tchem)
UniProt: O00311 A0A384MTU6
Structure
PDB: 

Position
1p22.1
AA seq 574 aa AA seqDB search
MEASLGIQMDEPMAFSPQRDRFQAEGSLKKNEQNFKLAGVKKDIEKLYEAVPQLSNVFKI
EDKIGEGTFSSVYLATAQLQVGPEEKIALKHLIPTSHPIRIAAELQCLTVAGGQDNVMGV
KYCFRKNDHVVIAMPYLEHESFLDILNSLSFQEVREYMLNLFKALKRIHQFGIVHRDVKP
SNFLYNRRLKKYALVDFGLAQGTHDTKIELLKFVQSEAQQERCSQNKSHIITGNKIPLSG
PVPKELDQQSTTKASVKRPYTNAQIQIKQGKDGKEGSVGLSVQRSVFGERNFNIHSSISH
ESPAVKLMKQSKTVDVLSRKLATKKKAISTKVMNSAVMRKTASSCPASLTCDCYATDKVC
SICLSRRQQVAPRAGTPGFRAPEVLTKCPNQTTAIDMWSAGVIFLSLLSGRYPFYKASDD
LTALAQIMTIRGSRETIQAAKTFGKSILCSKEVPAQDLRKLCERLRGMDSSTPKLTSDIQ
GHASHQPAISEKTDHKASCLVQTPPGQYSGNSFKKGDSNSCEHCFDEYNTNLEGWNEVPD
EAYDLLDKLLDLNPASRITAEEALLHPFFKDMSL
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggaggcgtctttggggattcagatggatgagccaatggctttttctccccagcgtgac
cggtttcaggctgaaggctctttaaaaaaaaacgagcagaattttaaacttgcaggtgtt
aaaaaagatattgagaagctttatgaagctgtaccacagcttagtaatgtgtttaagatt
gaggacaaaattggagaaggcactttcagctctgtttatttggccacagcacagttacaa
gtaggacctgaagagaaaattgctctaaaacacttgattccaacaagtcatcctataaga
attgcagctgaacttcagtgcctaacagtggctggggggcaagataatgtcatgggagtt
aaatactgctttaggaagaatgatcatgtagttattgctatgccatatctggagcatgag
tcgtttttggacattctgaattctctttcctttcaagaagtacgggaatatatgcttaat
ctgttcaaagctttgaaacgcattcatcagtttggtattgttcaccgtgatgttaagccc
agcaattttttatataataggcgcctgaaaaagtatgccttggtagactttggtttggcc
caaggaacccatgatacgaaaatagagcttcttaaatttgtccagtctgaagctcagcag
gaaaggtgttcacaaaacaaatcccacataatcacaggaaacaagattccactgagtggc
ccagtacctaaggagctggatcagcagtccaccacaaaagcttctgttaaaagaccctac
acaaatgcacaaattcagattaaacaaggaaaagacggaaaggagggatctgtaggcctt
tctgtccagcgctctgtttttggagaaagaaatttcaatatacacagctccatttcacat
gagagccctgcagtgaaactcatgaagcagtcaaagactgtggatgtactgtctagaaag
ttagcaacaaaaaagaaggctatttctacaaaagttatgaatagtgctgtgatgaggaaa
actgccagttcttgcccagctagcctgacctgtgactgctatgcaacagataaagtttgt
agtatttgcctttcaaggcgtcagcaggttgcccctagggcaggtacaccaggattcaga
gcaccagaggtcttgacaaagtgccccaatcaaactacagcaattgacatgtggtctgca
ggtgtcatatttctttctttgcttagtggacgatatccattttataaagcaagtgatgat
ttaactgctttggcccaaattatgacaattaggggatccagagaaactatccaagctgct
aaaacttttgggaaatcaatattatgtagcaaagaagttccagcacaagacttgagaaaa
ctctgtgagagactcaggggtatggattctagcactcccaagttaacaagtgatatacaa
gggcatgcttctcatcaaccagctatttcagagaagactgaccataaagcttcttgcctc
gttcaaacacctccaggacaatactcagggaattcatttaaaaagggggatagtaatagc
tgtgagcattgttttgatgagtataataccaatttagaaggctggaatgaggtacctgat
gaagcttatgacctgcttgataaacttctagatctaaatccagcttcaagaataacagca
gaagaagctttgttgcatccattttttaaagatatgagcttgtga

DBGET integrated database retrieval system