KEGG   Homo sapiens (human): 8324Help
Entry
8324              CDS       T01001                                 

Gene name
FZD7, FzE3
Definition
(RefSeq) frizzled class receptor 7
  KO
K02432  frizzled 1/7
Organism
hsa  Homo sapiens (human)
Pathway
hsa04150  mTOR signaling pathway
hsa04310  Wnt signaling pathway
hsa04390  Hippo signaling pathway
hsa04550  Signaling pathways regulating pluripotency of stem cells
hsa04916  Melanogenesis
hsa04934  Cushing syndrome
hsa05165  Human papillomavirus infection
hsa05200  Pathways in cancer
hsa05205  Proteoglycans in cancer
hsa05217  Basal cell carcinoma
hsa05224  Breast cancer
hsa05225  Hepatocellular carcinoma
hsa05226  Gastric cancer
Module
hsa_M00677  Wnt signaling
Network
N00056  Wnt signaling pathway
N00059  FZD7-overexpression to Wnt signaling pathway
N00060  LRP6-overexpression to Wnt signaling pathway
Disease
H00031  Breast cancer
H00048  Hepatocellular carcinoma
Drug target
Vantictumab: D10410
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    8324 (FZD7)
   04390 Hippo signaling pathway
    8324 (FZD7)
   04150 mTOR signaling pathway
    8324 (FZD7)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    8324 (FZD7)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    8324 (FZD7)
 09160 Human Diseases
  09161 Cancers: Overview
   05200 Pathways in cancer
    8324 (FZD7)
   05205 Proteoglycans in cancer
    8324 (FZD7)
  09162 Cancers: Specific types
   05225 Hepatocellular carcinoma
    8324 (FZD7)
   05226 Gastric cancer
    8324 (FZD7)
   05217 Basal cell carcinoma
    8324 (FZD7)
   05224 Breast cancer
    8324 (FZD7)
  09167 Endocrine and metabolic diseases
   04934 Cushing syndrome
    8324 (FZD7)
  09172 Infectious diseases: Viral
   05165 Human papillomavirus infection
    8324 (FZD7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:hsa04030]
    8324 (FZD7)
G protein-coupled receptors [BR:hsa04030]
 Frizzled / Smoothened family
  8324 (FZD7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Frizzled Fz Dicty_CAR
Motif
Other DBs
NCBI-GeneID: 8324
NCBI-ProteinID: NP_003498
OMIM: 603410
HGNC: 4045
Ensembl: ENSG00000155760
Vega: OTTHUMG00000132841
Pharos: O75084(Tbio)
UniProt: O75084
Structure
PDB: 

Position
2q33.1
AA seq 574 aa AA seqDB search
MRDPGAAAPLSSLGLCALVLALLGALSAGAGAQPYHGEKGISVPDHGFCQPISIPLCTDI
AYNQTILPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLDQAIPPC
RSLCERARQGCEALMNKFGFQWPERLRCENFPVHGAGEICVGQNTSDGSGGPGGGPTAYP
TAPYLPDLPFTALPPGASDGRGRPAFPFSCPRQLKVPPYLGYRFLGERDCGAPCEPGRAN
GLMYFKEEERRFARLWVGVWSVLCCASTLFTVLTYLVDMRRFSYPERPIIFLSGCYFMVA
VAHVAGFLLEDRAVCVERFSDDGYRTVAQGTKKEGCTILFMVLYFFGMASSIWWVILSLT
WFLAAGMKWGHEAIEANSQYFHLAAWAVPAVKTITILAMGQVDGDLLSGVCYVGLSSVDA
LRGFVLAPLFVYLFIGTSFLLAGFVSLFRIRTIMKHDGTKTEKLEKLMVRIGVFSVLYTV
PATIVLACYFYEQAFREHWERTWLLQTCKSYAVPCPPGHFPPMSPDFTVFMIKYLMTMIV
GITTGFWIWSGKTLQSWRRFYHRLSHSSKGETAV
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaccccggcgcggccgctccgctttcgtccctgggcctctgtgccctggtgctg
gcgctgctgggcgcactgtccgcgggcgccggggcgcagccgtaccacggagagaagggc
atctccgtgccggaccacggcttctgccagcccatctccatcccgctgtgcacggacatc
gcctacaaccagaccatcctgcccaacctgctgggccacacgaaccaagaggacgcgggc
ctcgaggtgcaccagttctacccgctggtgaaggtgcagtgttctcccgaactccgcttt
ttcttatgctccatgtatgcgcccgtgtgcaccgtgctcgatcaggccatcccgccgtgt
cgttctctgtgcgagcgcgcccgccagggctgcgaggcgctcatgaacaagttcggcttc
cagtggcccgagcggctgcgctgcgagaacttcccggtgcacggtgcgggcgagatctgc
gtgggccagaacacgtcggacggctccgggggcccaggcggcggccccactgcctaccct
accgcgccctacctgccggacctgcccttcaccgcgctgcccccgggggcctcagatggc
agggggcgtcccgccttccccttctcatgcccccgtcagctcaaggtgcccccgtacctg
ggctaccgcttcctgggtgagcgcgattgtggcgccccgtgcgaaccgggccgtgccaac
ggcctgatgtactttaaggaggaggagaggcgcttcgcccgcctctgggtgggcgtgtgg
tccgtgctgtgctgcgcctcgacgctctttaccgttctcacctacctggtggacatgcgg
cgcttcagctacccagagcggcccatcatcttcctgtcgggctgctacttcatggtggcc
gtggcgcacgtggccggcttccttctagaggaccgcgccgtgtgcgtggagcgcttctcg
gacgatggctaccgcacggtggcgcagggcaccaagaaggagggctgcaccatcctcttc
atggtgctctacttcttcggcatggccagctccatctggtgggtcattctgtctctcact
tggttcctggcggccggcatgaagtggggccacgaggccatcgaggccaactcgcagtac
ttccacctggccgcgtgggccgtgcccgccgtcaagaccatcactatcctggccatgggc
caggtagacggggacctgctgagcggggtgtgctacgttggcctctccagtgtggacgcg
ctgcggggcttcgtgctggcgcctctgttcgtctacctcttcataggcacgtccttcttg
ctggccggcttcgtgtccctcttccgtatccgcaccatcatgaaacacgacggcaccaag
accgagaagctggagaagctcatggtgcgcatcggcgtcttcagcgtgctctacacagtg
cccgccaccatcgtcctggcctgctacttctacgagcaggccttccgcgagcactgggag
cgcacctggctcctgcagacgtgcaagagctatgccgtgccctgcccgcccggccacttc
ccgcccatgagccccgacttcaccgtcttcatgatcaagtacctgatgaccatgatcgtc
ggcatcaccactggcttctggatctggtcgggcaagaccctgcagtcgtggcgccgcttc
taccacagacttagccacagcagcaagggggagactgcggtatga

DBGET integrated database retrieval system