KEGG   Homo sapiens (human): 833
Entry
833               CDS       T01001                                 
Symbol
CARS1, CARS, CYSRS, MCDDBH, MDBH, MGC:11246
Name
(RefSeq) cysteinyl-tRNA synthetase 1
  KO
K01883  cysteinyl-tRNA synthetase [EC:6.1.1.16]
Organism
hsa  Homo sapiens (human)
Pathway
hsa00970  Aminoacyl-tRNA biosynthesis
Disease
H02132  Microcephaly syndrome
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    833 (CARS1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:hsa01007]
    833 (CARS1)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:hsa03016]
    833 (CARS1)
Enzymes [BR:hsa01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.16  cysteine---tRNA ligase
     833 (CARS1)
Amino acid related enzymes [BR:hsa01007]
 Aminoacyl-tRNA synthetase
  Class I (G)
   833 (CARS1)
Transfer RNA biogenesis [BR:hsa03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    833 (CARS1)
 Prokaryotic type
    833 (CARS1)
SSDB
Motif
Pfam: tRNA-synt_1e tRNA-synt_1g tRNA-synt_1 ROK
Other DBs
NCBI-GeneID: 833
NCBI-ProteinID: NP_001742
OMIM: 123859
HGNC: 1493
Ensembl: ENSG00000110619
Pharos: P49589(Tbio)
UniProt: P49589 A0A024RCG3
Position
11:complement(3000929..3057423)
AA seq 748 aa
MADSSGQQGKGRRVQPQWSPPAGTQPCRLHLYNSLTRNKEVFIPQDGKKVTWYCCGPTVY
DASHMGHARSYISFDILRRVLKDYFKFDVFYCMNITDIDDKIIKRARQNHLFEQYREKRP
EAAQLLEDVQAALKPFSVKLNETTDPDKKQMLERIQHAVQLATEPLEKAVQSRLTGEEVN
SCVEVLLEEAKDLLSDWLDSTLGCDVTDNSIFSKLPKFWEGDFHRDMEALNVLPPDVLTR
VSEYVPEIVNFVQKIVDNGYGYVSNGSVYFDTAKFASSEKHSYGKLVPEAVGDQKALQEG
EGDLSISADRLSEKRSPNDFALWKASKPGEPSWPCPWGKGRPGWHIECSAMAGTLLGASM
DIHGGGFDLRFPHHDNELAQSEAYFENDCWVRYFLHTGHLTIAGCKMSKSLKNFITIKDA
LKKHSARQLRLAFLMHSWKDTLDYSSNTMESALQYEKFLNEFFLNVKDILRAPVDITGQF
EKWGEEEAELNKNFYDKKTAIHKALCDNVDTRTVMEEMRALVSQCNLYMAARKAVRKRPN
QALLENIALYLTHMLKIFGAVEEDSSLGFPVGGPGTSLSLEATVMPYLQVLSEFREGVRK
IAREQKVPEILQLSDALRDNILPELGVRFEDHEGLPTVVKLVDRNTLLKEREEKRRVEEE
KRKKKEEAARRKQEQEAAKLAKMKIPPSEMFLSETDKYSKFDENGLPTHDMEGKELSKGQ
AKKLKKLFEAQEKLYKEYLQMAQNGSFQ
NT seq 2247 nt   +upstreamnt  +downstreamnt
atggcagattcctccgggcagcagggcaaaggccggcgtgtgcagccccagtggtcccct
cctgctgggacccagccatgcagactccacctttacaacagcctcaccaggaacaaggaa
gtgttcatacctcaagatgggaaaaaggtgacgtggtattgctgtgggccaaccgtctat
gacgcatctcacatggggcacgccaggtcctacatctcttttgatatcttgagaagagtg
ttgaaggattacttcaaatttgatgtcttttattgcatgaacattacggatattgatgac
aagatcatcaagagggcccggcagaaccacctgttcgagcagtatcgggagaagaggcct
gaagcggcacagctcttggaggatgttcaggccgccctgaagccattttcagtaaaatta
aatgagaccacggatcccgataaaaagcagatgctcgaacggattcagcacgcagtgcag
cttgccacagagccacttgagaaagctgtgcagtccagactcacgggagaggaagtcaac
agctgtgtggaggtgttgctggaagaagccaaggatttgctctctgactggctggattct
acacttggctgtgatgtcactgacaattccatcttctccaagctgcccaagttctgggag
ggggacttccacagagacatggaagctctgaatgttctccctccagatgtcttaacccgg
gttagtgagtatgtgccagaaattgtgaactttgtccagaagattgtggacaacggttac
ggctatgtctccaatgggtctgtctactttgatacagcgaagtttgcttctagcgagaag
cactcctatgggaagctggtgcctgaggccgttggagatcagaaagcccttcaagaaggg
gaaggtgacctgagcatctctgcagaccgcctgagtgagaagcgctctcccaacgacttt
gccttatggaaggcctctaagcccggagaaccgtcctggccgtgcccttggggaaagggt
cgtccgggctggcatatcgagtgctcggccatggcaggcaccctcctaggggcttcgatg
gacattcacggaggtgggttcgacctccggttcccccaccatgacaatgagctggcacag
tcggaggcctactttgaaaacgactgctgggtcaggtacttcctgcacacaggccacctg
accattgcaggctgcaaaatgtcaaagtcactaaaaaacttcatcaccattaaagatgcc
ttgaaaaagcactcagcacggcagttgcggctggccttcctcatgcactcgtggaaggac
accctggactactccagcaacaccatggagtcagcgcttcaatatgagaagttcttgaat
gagtttttcttaaatgtgaaagatatccttcgcgctcctgttgacatcactggtcagttt
gagaagtggggagaagaagaagcagaactgaataagaacttttatgacaagaagacagca
attcacaaagccctctgtgacaatgttgacacccgcaccgtcatggaagagatgcgggcc
ttggtcagtcagtgcaacctctatatggcagcccggaaagccgtgaggaagaggcccaac
caggctctgctggagaacatcgccctgtacctcacccatatgctgaagatctttggggcc
gtagaagaggacagctccctgggattcccggtcggagggcctggaaccagcctcagtctc
gaggccacagtcatgccctaccttcaggtgttatcagaattccgagaaggagtgcggaag
attgcccgagagcaaaaagtccctgagattctgcagctcagcgatgccctgcgggacaac
atcctgcccgagcttggggtgcggtttgaagaccacgaaggactgcccacagtggtgaaa
ctggtagacagaaacaccttattaaaagagagagaagaaaagagacgggttgaagaggag
aagaggaagaagaaagaggaggcggcccggaggaaacaggaacaagaagcagcaaagctg
gccaagatgaagattccccccagtgagatgttcttgtcagaaaccgacaaatactccaag
tttgatgaaaatggtctgcccacacatgacatggagggcaaagagctcagcaaagggcaa
gccaagaagctgaagaagctcttcgaggctcaggagaagctctacaaggaatatctgcag
atggcccagaatggaagcttccagtga

DBGET integrated database retrieval system