KEGG   Homo sapiens (human): 8330
Entry
8330              CDS       T01001                                 

Gene name
H2AC15, H2A.1, H2A/d, H2AC11, H2AC13, H2AC14, H2AC16, H2AC17, H2AFD, HIST1H2AK
Definition
(RefSeq) H2A clustered histone 15
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8330 (H2AC15)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8330 (H2AC15)
  09165 Substance dependence
   05034 Alcoholism
    8330 (H2AC15)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8330 (H2AC15)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8330 (H2AC15)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8330 (H2AC15)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8330 (H2AC15)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8330
NCBI-ProteinID: NP_003501
OMIM: 602788
HGNC: 4726
Ensembl: ENSG00000275221
Vega: OTTHUMG00000016382
UniProt: P0C0S8 A4FTV9
Structure
PDB: 
6RNY 6R0C 6FML 5KGF

Position
6p22.1
AA seq 130 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt   +upstreamnt  +downstreamnt
atgtcgggacgtggcaagcagggcggcaaagctcgcgccaaggctaagacccgttcttca
agggcgggtcttcagttcccagtgggccgagtgcaccgactgctccgcaagggcaactac
gctgagcgggtcggtgccggagcgccggtgtacctggcggcggtgttggagtacctaacc
gccgagatcctggaactggctggcaacgcggcccgcgacaacaagaagacccgcatcatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgcttggtaaa
gtgaccatcgcccagggtggtgtcctgcccaatatccaggccgtgctgctgcctaagaaa
actgagagccaccacaaggccaagggcaagtag

DBGET integrated database retrieval system