KEGG   Homo sapiens (human): 8331
Entry
8331              CDS       T01001                                 

Gene name
H2AC14, H2A/E, H2AFE, HIST1H2AJ, dJ160A22.4
Definition
(RefSeq) H2A clustered histone 14
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8331 (H2AC14)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8331 (H2AC14)
  09165 Substance dependence
   05034 Alcoholism
    8331 (H2AC14)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8331 (H2AC14)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8331 (H2AC14)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8331 (H2AC14)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8331 (H2AC14)
SSDB
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Other DBs
NCBI-GeneID: 8331
NCBI-ProteinID: NP_066544
OMIM: 602791
HGNC: 4727
Ensembl: ENSG00000276368
Vega: OTTHUMG00000014486
Pharos: Q99878(Tdark)
UniProt: Q99878
Position
6p22.1
AA seq 128 aa
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKTK
NT seq 387 nt   +upstreamnt  +downstreamnt
atgtctgggcgtggtaagcagggaggcaaagctcgcgccaaggccaagacccgctcttct
cgggccgggcttcagtttcccgtaggccgagtgcatcgcctgctccgcaaaggcaactat
gcggagcgggtcggtgctggagcgccggtgtacctggcggcggtgctggagtacctgacc
gccgagatcctggagctggctggcaacgcggcccgcgacaacaagaagactcgcatcatc
ccgcgtcacctccagctggccatccgcaacgatgaggagctcaacaagcttctgggcaaa
gtcaccatcgcacagggtggcgtcctgcccaacatccaggccgtgctgctgccaaagaaa
actgagagccaccacaagactaagtaa

DBGET integrated database retrieval system