KEGG   Homo sapiens (human): 8332Help
Entry
8332              CDS       T01001                                 

Gene name
H2AC16, H2A.i, H2A/i, H2AFI, HIST1H2AL, dJ193B12.9
Definition
(RefSeq) H2A clustered histone 16
  KO
K11251  histone H2A
Organism
hsa  Homo sapiens (human)
Pathway
hsa04217  Necroptosis
hsa05034  Alcoholism
hsa05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:hsa00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    8332 (H2AC16)
 09160 Human Diseases
  09163 Immune disease
   05322 Systemic lupus erythematosus
    8332 (H2AC16)
  09165 Substance dependence
   05034 Alcoholism
    8332 (H2AC16)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:hsa03036]
    8332 (H2AC16)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:hsa04147]
    8332 (H2AC16)
Chromosome and associated proteins [BR:hsa03036]
 Eukaryotic type
  Nucleosome assembly factors
   Histones
    8332 (H2AC16)
Exosome [BR:hsa04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   8332 (H2AC16)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone_H2A_C Histone CBFD_NFYB_HMF Ribosomal_L27A
Motif
Other DBs
NCBI-GeneID: 8332
NCBI-ProteinID: NP_003502
OMIM: 602793
HGNC: 4730
Ensembl: ENSG00000276903
Vega: OTTHUMG00000014492
UniProt: P0C0S8 A4FTV9
Structure
PDB: 

Position
6p22.1
AA seq 130 aa AA seqDB search
MSGRGKQGGKARAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT
AEILELAGNAARDNKKTRIIPRHLQLAIRNDEELNKLLGKVTIAQGGVLPNIQAVLLPKK
TESHHKAKGK
NT seq 393 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggacgcggcaagcagggaggcaaagctcgcgccaaagccaagacccgctcttct
cgtgccggtctccagttccccgtgggccgagtgcaccgactgctccgcaagggcaactat
gctgagcgggtcggggccggcgcgccggtgtacctggcggcggtgctggagtacctgact
gccgagatcctggagctggcgggcaacgccgcccgcgacaacaagaagacccgcattatc
ccgcgccacttgcagctggccatccgcaacgacgaggagctcaacaagctgctgggcaaa
gtaaccatcgctcagggtggtgtcctgcccaacatccaggctgtgctactgcccaagaag
accgagagtcaccacaaggccaaaggcaaataa

DBGET integrated database retrieval system